Aminopeptidase P2/XPNPEP2 Antibody - BSA Free

Staining of human cell line ASC TERT1 shows localization to plasma membrane & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aminopeptidase P2/XPNPEP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aminopeptidase P2/XPNPEP2 Antibody - BSA Free (NBP3-21303) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPNPEP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aminopeptidase P2/XPNPEP2 Antibody - BSA Free

• Aminoacylproline aminopeptidase
• Aminopeptidase P2
• APP2
• EC 3.4.11.9
• mAmP
• Membrane-bound aminopeptidase P
• Membrane-bound AmP
• Membrane-bound APP
• xaa-Pro aminopeptidase 2
• XPNPEP2
• X-Pro aminopeptidase 2
• X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound

Background

Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XPNPEP2