Aminopeptidase P1/XPNPEP1 Antibody - BSA Free

Western Blot: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80613] - Analysis using Anti-XPNPEP1 antibody NBP1-80613 (A) shows similar pattern to independent antibody NBP1-80614 (B).

Immunocytochemistry/Immunofluorescence: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80613] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80613] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Western Blot: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80613] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Western Blot: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80613] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aminopeptidase P1/XPNPEP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPNPEP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Aminopeptidase P1/XPNPEP1 Protein (NBP1-80613PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aminopeptidase P1/XPNPEP1 Antibody - BSA Free

• Aminoacylproline aminopeptidase
• Aminopeptidase P1
• APP1
• Cytosolic aminopeptidase P
• cytosolic
• EC 3.4.11.9
• SAMP
• xaa-Pro aminopeptidase 1
• XPNPEP1
• XPNPEPLX-prolyl aminopeptidase (aminopeptidase P)-like
• X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
• X-prolyl aminopeptidase 1, soluble

Background

XPNPEP1 is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. As a result of its specificity toward proline, it has been suggested that XPNPEP1 is important in the maturation and degradation of peptide hormones, neuropeptides, and tachykinins, as well as in the digestion of otherwise resistant dietary protein fragments, thereby complementing the pancreatic peptidases. Deficiency of XPNPEP1 results in excretion of large amounts of imino-oligopeptides in urine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80613)(1)

Publication using NBP1-80613

• Lin C, Yang Q, Guo D et al. Impaired mitochondrial oxidative metabolism in skeletal progenitor cells leads to musculoskeletal disintegration Nature communications 2022-11-11 [PMID: 36369293] (WB, Mouse)

Bioinformatics

• Gene Symbol: XPNPEP1
• Entrez:
  • 7511(Human)
• Uniprot:
  • Q9NQW7()