Aminopeptidase P1/XPNPEP1 Antibody - BSA Free

Images

 
Independent Antibodies: Western Blot: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80614] - Analysis using Anti-XPNPEP1 antibody NBP1-80614 (A) shows similar pattern to independent antibody NBP1-80613 (B).
Immunocytochemistry/ Immunofluorescence: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80614] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80614] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
5 gamma H2AX foci from three experiments, bars show mean of the three experiments, and error bars represent standard deviations. Statistical significance was calculated by a one-way ANOVA test, note that differences between siRNA control and the two siRNAs targeting XPNPEP1 are significant (* indicates P value = 0.048 and ** indicates P value = 0.0082). (D) Western blot analysis on fractionated protein extracts from U2OS cells treated with control siRNA and two independent XPNPEP1 siRNAs showing that Topoisomerase II accumulates on the DNA-bound fraction following XPNPEP1 knockdown. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35081133), licensed under a CC-BY license. Not internally tested by Novus Biologicals." > 5 gamma H2AX foci from three experiments, bars show mean of the three experiments, and error bars represent standard deviations. Statistical significance was calculated by a one-way ANOVA test, note that differences between siRNA control and the two siRNAs targeting XPNPEP1 are significant (* indicates P value = 0.048 and ** indicates P value = 0.0082). (D) Western blot analysis on fractionated protein extracts from U2OS cells treated with control siRNA and two independent XPNPEP1 siRNAs showing that Topoisomerase II accumulates on the DNA-bound fraction following XPNPEP1 knockdown. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35081133), licensed under a CC-BY license. Not internally tested by Novus Biologicals." title="Knockdown of human XPNPEP1 causes accumulation of DNA damage.(A) Western blot analysis on total protein extracts showing efficient knock down of XPNPEP1 by two independent siRNAs that also induce accumulation of Topoisomerase II alpha . (Β) Pulse field gel stained with ethidium bromide in control cells and following knock down of XPNPEP1. Note increased intensity of band labelled as “a" and the smear label as “b" corresponding to fragmented DNA. Graphs show quantification of the relative intensity of band “a" and smear “b". (C)XPNPEP1 knockdown causes an increase in the % of cells positive for gamma H2AX. Dots show % of cells with >5 gamma H2AX foci from three experiments, bars show mean of the three experiments, and error bars represent standard deviations. Statistical significance was calculated by a one-way ANOVA test, note that differences between siRNA control and the two siRNAs targeting XPNPEP1 are significant (* indicates P value = 0.048 and ** indicates P value = 0.0082). (D) Western blot analysis on fractionated protein extracts from U2OS cells treated with control siRNA and two independent XPNPEP1 siRNAs showing that Topoisomerase II accumulates on the DNA-bound fraction following XPNPEP1 knockdown. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35081133), licensed under a CC-BY license. Not internally tested by Novus Biologicals." />
Knockdown of human XPNPEP1 causes accumulation of DNA damage.(A) Western blot analysis on total protein extracts showing efficient knock down of XPNPEP1 by two independent siRNAs that also induce accumulation of ...read more
5 gamma H2AX foci from three experiments, bars show mean of the three experiments, and error bars represent standard deviations. Statistical significance was calculated by a one-way ANOVA test, note that differences between siRNA control and the two siRNAs targeting XPNPEP1 are significant (* indicates P value = 0.048 and ** indicates P value = 0.0082). (D) Western blot analysis on fractionated protein extracts from U2OS cells treated with control siRNA and two independent XPNPEP1 siRNAs showing that Topoisomerase II accumulates on the DNA-bound fraction following XPNPEP1 knockdown. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35081133), licensed under a CC-BY license. Not internally tested by Novus Biologicals." > 5 gamma H2AX foci from three experiments, bars show mean of the three experiments, and error bars represent standard deviations. Statistical significance was calculated by a one-way ANOVA test, note that differences between siRNA control and the two siRNAs targeting XPNPEP1 are significant (* indicates P value = 0.048 and ** indicates P value = 0.0082). (D) Western blot analysis on fractionated protein extracts from U2OS cells treated with control siRNA and two independent XPNPEP1 siRNAs showing that Topoisomerase II accumulates on the DNA-bound fraction following XPNPEP1 knockdown. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35081133), licensed under a CC-BY license. Not internally tested by Novus Biologicals." title="Knockdown of human XPNPEP1 causes accumulation of DNA damage.(A) Western blot analysis on total protein extracts showing efficient knock down of XPNPEP1 by two independent siRNAs that also induce accumulation of Topoisomerase II alpha . (Β) Pulse field gel stained with ethidium bromide in control cells and following knock down of XPNPEP1. Note increased intensity of band labelled as “a" and the smear label as “b" corresponding to fragmented DNA. Graphs show quantification of the relative intensity of band “a" and smear “b". (C)XPNPEP1 knockdown causes an increase in the % of cells positive for gamma H2AX. Dots show % of cells with >5 gamma H2AX foci from three experiments, bars show mean of the three experiments, and error bars represent standard deviations. Statistical significance was calculated by a one-way ANOVA test, note that differences between siRNA control and the two siRNAs targeting XPNPEP1 are significant (* indicates P value = 0.048 and ** indicates P value = 0.0082). (D) Western blot analysis on fractionated protein extracts from U2OS cells treated with control siRNA and two independent XPNPEP1 siRNAs showing that Topoisomerase II accumulates on the DNA-bound fraction following XPNPEP1 knockdown. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35081133), licensed under a CC-BY license. Not internally tested by Novus Biologicals." />
Knockdown of human XPNPEP1 causes accumulation of DNA damage.(A) Western blot analysis on total protein extracts showing efficient knock down of XPNPEP1 by two independent siRNAs that also induce accumulation of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Aminopeptidase P1/XPNPEP1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XPNPEP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aminopeptidase P1/XPNPEP1 Protein (NBP1-80614PEP)
Publications
Read Publications using
NBP1-80614 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Aminopeptidase P1/XPNPEP1 Antibody - BSA Free

  • Aminoacylproline aminopeptidase
  • Aminopeptidase P1
  • APP1
  • Cytosolic aminopeptidase P
  • cytosolic
  • EC 3.4.11.9
  • SAMP
  • xaa-Pro aminopeptidase 1
  • XPNPEP1
  • XPNPEPLX-prolyl aminopeptidase (aminopeptidase P)-like
  • X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
  • X-prolyl aminopeptidase 1, soluble

Background

XPNPEP1 is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. As a result of its specificity toward proline, it has been suggested that XPNPEP1 is important in the maturation and degradation of peptide hormones, neuropeptides, and tachykinins, as well as in the digestion of otherwise resistant dietary protein fragments, thereby complementing the pancreatic peptidases. Deficiency of XPNPEP1 results in excretion of large amounts of imino-oligopeptides in urine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBL1-17057
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-56490
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
AF6517
Species: Hu
Applications: WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF1396
Species: Hu
Applications: WB
NBP1-86535
Species: Hu
Applications: IHC,  IHC-P
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-80614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80614)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: WB, Western Blot.


Filter By Application
WB
(1)
Western Blot
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80614) (0)

There are no reviews for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminopeptidase P1/XPNPEP1 Products

Research Areas for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80614)

Find related products by research area.

Blogs on Aminopeptidase P1/XPNPEP1

There are no specific blogs for Aminopeptidase P1/XPNPEP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminopeptidase P1/XPNPEP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol XPNPEP1
Entrez
Uniprot