Aminopeptidase P1/XPNPEP1 Antibody - BSA Free

Western Blot: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80614] - Analysis using Anti-XPNPEP1 antibody NBP1-80614 (A) shows similar pattern to independent antibody NBP1-80613 (B).

Immunocytochemistry/Immunofluorescence: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80614] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: Aminopeptidase P1/XPNPEP1 Antibody [NBP1-80614] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aminopeptidase P1/XPNPEP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aminopeptidase P1/XPNPEP1 Antibody - BSA Free (NBP1-80614) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Aminopeptidase P1/XPNPEP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPNPEP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aminopeptidase P1/XPNPEP1 Protein (NBP1-80614PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aminopeptidase P1/XPNPEP1 Antibody - BSA Free

• Aminoacylproline aminopeptidase
• Aminopeptidase P1
• APP1
• Cytosolic aminopeptidase P
• cytosolic
• EC 3.4.11.9
• SAMP
• xaa-Pro aminopeptidase 1
• XPNPEP1
• XPNPEPLX-prolyl aminopeptidase (aminopeptidase P)-like
• X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
• X-prolyl aminopeptidase 1, soluble

Background

XPNPEP1 is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. As a result of its specificity toward proline, it has been suggested that XPNPEP1 is important in the maturation and degradation of peptide hormones, neuropeptides, and tachykinins, as well as in the digestion of otherwise resistant dietary protein fragments, thereby complementing the pancreatic peptidases. Deficiency of XPNPEP1 results in excretion of large amounts of imino-oligopeptides in urine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aminopeptidase P1/XPNPEP1 Antibody (NBP1-80614)(2)

Publications using NBP1-80614

• Moore TM, Cheng L, Wolf DM et al. Parkin regulates adiposity by coordinating mitophagy with mitochondrial biogenesis in white adipocytes Nature communications 2022-11-04 [PMID: 36333379] (WB, Mouse)
• Silva N, Castellano-Pozo M, Matsuzaki K et al. Proline-specific aminopeptidase P prevents replication-associated genome instability PLOS Genetics 2022-01-26 [PMID: 35081133] (Western Blot)

Bioinformatics

• Gene Symbol: XPNPEP1
• Entrez:
  • 7511(Human)
• Uniprot:
  • Q9NQW7()
  • Q9NQW7()
  • Q9NQW7()
  • Q9NQW7()