alpha Tubulin 4a Antibody [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related alpha Tubulin 4a Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38636AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

alpha Tubulin 4a Antibody [Alexa Fluor® 488] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human alpha Tubulin 4a (NP_005991.1).

Sequence:
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBA4A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for alpha Tubulin 4a Antibody [Alexa Fluor® 488]

  • alpha 1 (testis specific)
  • alpha Tubulin 4a
  • Alpha-tubulin 1
  • FLJ30169
  • H2-ALPHA
  • Testis-specific alpha-tubulin
  • TUBA1
  • TUBA4A
  • Tubulin alpha-1 chain
  • tubulin alpha-4A chain
  • Tubulin H2-alpha
  • tubulin, alpha 1
  • tubulin, alpha 4a

Background

Microtubules are involved in a wide variety of cellular activities ranging from mitosis and transport events to cell movement and the maintainance of cell shape. Tubulin itself is a globular protein which consists of two polypeptides (alpha and beta tubulin). Alpha and beta tubulin dimers are assembled to 13 protofilaments that form a microtubule of 22 nm diameter. Tyrosine ligase ads a C-terminal tyrosin to monomeric alpha tubulin. Assembled microtubules can again be detyrosinated by a cytoskeleton associated carboxypeptidase. Detyrosinated alpha tubulin is referred to as Glu-tubulin. Another post-translational modification of detyrosinated alpha tubulin is C-terminal polyglutamylation which is characteristic for microtubules in neuronal cells and the mitotic spindle. Alpha tubulin is not suitable as loading control in adipose tissue as expression of tubulin in adipose tissue is very low ( Spiegelman and Farmer, Cell, 1982, 29(1):53-60) in cells undergoing adipose differentiation actin synthesis decreases by 90%. Excellent as a protein loading control antibody.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, RIA, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
U-100H
Species: Hu
Applications: EnzAct
NBP3-25485
Species: Ca, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-690
Species: Av, Bv, Ca, Ch, ChHa, Dr, Fu, Gt, Gp, Ha, Hu, Pm, Mu, Pa, Po, Pm, Rb, Rt, Xp, Ye
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, Simple Western, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1992
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP3-46814
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38636AF488
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for alpha Tubulin 4a Antibody (NBP3-38636AF488) (0)

There are no publications for alpha Tubulin 4a Antibody (NBP3-38636AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha Tubulin 4a Antibody (NBP3-38636AF488) (0)

There are no reviews for alpha Tubulin 4a Antibody (NBP3-38636AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha Tubulin 4a Antibody (NBP3-38636AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha Tubulin 4a Products

Research Areas for alpha Tubulin 4a Antibody (NBP3-38636AF488)

Find related products by research area.

Blogs on alpha Tubulin 4a.

Tubulin alpha 4A - A ubiquitous tubulin isoform linked to ALS and infertility
Microtubules are a main component of the cytoskeleton and play essential roles in a variety of cellular processes. These highly dynamic tubular structures are assembled from alpha- and beta-tubulin dimers to form a complex structural network of mic...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha Tubulin 4a Antibody [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBA4A