We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

alpha 1 Mannosidase 1A Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human liver shows moderate positivity in bile canaliculi.
Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human duodenum shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemistry-Paraffin: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human kidney shows moderate to strong positivity in Golgi apparatus in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

alpha 1 Mannosidase 1A Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAN1A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for alpha 1 Mannosidase 1A Antibody - BSA Free

  • Alpha-1,2-mannosidase IA
  • EC 3.2.1
  • EC 3.2.1.113
  • HUMM3
  • HUMM9
  • man(9)-alpha-mannosidase
  • MAN9
  • Man9-mannosidase
  • Mannosidase alpha class 1A member 1
  • mannosidase, alpha, class 1A, member 1
  • mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
  • Processing alpha-1,2-mannosidase IA

Background

a1,2-Mannosidase IA is a Type II transmembrane Golgi-resident enzyme that belongs to class I a1,2-Mannosidases (glycosylhydrolase family 47). a1,2-Mannosidases plays an essential role in the maturation of N-glycans to hybrid and complex oligosaccharides in mammalian cells. Class I a1,2- Mannosidases are conserved through evolution. They can be classified into three subgroups according to their enzymatic activities. The first subgroup includes yeast and human endoplasmic reticulum (ER) a1,2-Mannosidases that primarily trim Man9GlcNAc2 to Man8GlcNAc2 isomer B. The second subgroup includes mammalian Golgi a1,2-Mannosidases IA, IB, and IC that trim Man9GlcNAc2 to Man5GlcNAc2 through Man8GlcNAc2 isomer A and C. These Golgi mannosidases display different tissue- and cell-specific expression, subcellular localization, and substrate specificity. The third subgroup includes yeast and mammalian proteins that do not hydrolyze Man9GlcNAc2. Proteins from subgroup 1 and 3 have been implicated in ER quality control and in proteasomal degradation of misfolded glycoproteins. It was also suggested that Golgi mannosidases from the second subgroup may play a role in the ERAD (endoplasmic reticulum-associated degradation) of defective glycoproteins 1-5. Although a1,2-Mannosidase IA is predominantly detected in the juxtanuclear Golgi region by indirect immunofluorescence, significant cell type and speciesdependent variation in localization was reported. The pig liver enzyme has been localized to the ER and transitional vesicles between ER and Golgi, but is not found within the Golgi stacks of porcine hepatocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-93304
Species: ChHa, Hu
Applications: IP, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP1-82802
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90813
Species: Hu
Applications: IHC,  IHC-P, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01294
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-49174
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83435
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87831
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-17218
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-46425
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-37938
Species: Hu
Applications: ICC/IF, IHC

Publications for alpha 1 Mannosidase 1A Antibody (NBP2-37938) (0)

There are no publications for alpha 1 Mannosidase 1A Antibody (NBP2-37938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 1 Mannosidase 1A Antibody (NBP2-37938) (0)

There are no reviews for alpha 1 Mannosidase 1A Antibody (NBP2-37938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for alpha 1 Mannosidase 1A Antibody (NBP2-37938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha 1 Mannosidase 1A Products

Research Areas for alpha 1 Mannosidase 1A Antibody (NBP2-37938)

Find related products by research area.

Blogs on alpha 1 Mannosidase 1A

There are no specific blogs for alpha 1 Mannosidase 1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha 1 Mannosidase 1A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN1A1
Uniprot