MAN1A2 Antibody

Images

 
Western Blot: MAN1A2 Antibody [NBP1-82802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-330
Immunocytochemistry/ Immunofluorescence: MAN1A2 Antibody [NBP1-82802] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human placenta shows strong positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAN1A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAN1A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAN1A2 Protein (NBP1-82802PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82802 in the following applications:

Publications
Read Publication using
NBP1-82802 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAN1A2 Antibody

  • Alpha-1,2-mannosidase IB
  • EC 3.2.1.113
  • MAN1Balpha1,2-mannosidase
  • Mannosidase alpha class 1A member 2
  • mannosidase, alpha, class 1A, member 2
  • mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
  • Processing alpha-1,2-mannosidase IB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-83764
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-88342
Species: Hu
Applications: IHC, IHC-P
NBP2-01294
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59953
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-519
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-977
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86802
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
640-A3
Species: Mu
NBP1-82802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAN1A2 Antibody (NBP1-82802)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for MAN1A2 Antibody (NBP1-82802) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82802:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Human 04/28/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAN1A2 Antibody (NBP1-82802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAN1A2 Products

Bioinformatics Tool for MAN1A2 Antibody (NBP1-82802)

Discover related pathways, diseases and genes to MAN1A2 Antibody (NBP1-82802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAN1A2 Antibody (NBP1-82802)

Discover more about diseases related to MAN1A2 Antibody (NBP1-82802).
 

Pathways for MAN1A2 Antibody (NBP1-82802)

View related products by pathway.

PTMs for MAN1A2 Antibody (NBP1-82802)

Learn more about PTMs related to MAN1A2 Antibody (NBP1-82802).

Blogs on MAN1A2

There are no specific blogs for MAN1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Anonymous
04/28/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol MAN1A2
Entrez
Uniprot