MAN1A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining in human placenta and skeletal muscle tissues . Corresponding MAN1A2 RNA-seq data are presented for the same tissues.

Western Blot: MAN1A2 Antibody [NBP1-82802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-330

Immunocytochemistry/Immunofluorescence: MAN1A2 Antibody [NBP1-82802] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human skeletal muscle shows very weak positivity in myocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAN1A2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAN1A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 24591635). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAN1A2 Protein (NBP1-82802PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAN1A2 Antibody - BSA Free

• Alpha-1,2-mannosidase IB
• EC 3.2.1.113
• MAN1A2
• MAN1B
• MAN1Balpha1,2-mannosidase
• Mannosidase alpha class 1A member 2
• mannosidase, alpha, class 1A, member 2
• mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
• Processing alpha-1,2-mannosidase IB

Background

Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAN1A2 Antibody (NBP1-82802)(1)

Publication using NBP1-82802

• Agrawal P, Kurcon T, Pilobello KT et al. Mapping posttranscriptional regulation of the human glycome uncovers microRNA defining the glycocode Proc Natl Acad Sci U S A. 2014-03-18 [PMID: 24591635] (WB, Human)

Review for MAN1A2 Antibody (NBP1-82802) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 04/28/2014

Summary

• Application: Western Blot
• Species: Human

Bioinformatics

• Gene Symbol: MAN1A2
• Entrez:
  • 10905(Human)
• Uniprot:
  • O60476(Human)