![Western Blot: MAN1A2 Antibody [NBP1-82802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-330](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Western-Blot-NBP1-82802-img0005.jpg "Western Blot: MAN1A2 Antibody [NBP1-82802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-330")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK |
| Specificity | Specificity of human MAN1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAN1A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 24591635). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82802 | Applications | Species |
|---|---|---|
| Agrawal P, Kurcon T, Pilobello KT et al. Mapping posttranscriptional regulation of the human glycome uncovers microRNA defining the glycocode Proc Natl Acad Sci U S A. 2014 Mar 18 [PMID: 24591635] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Anonymous |
WB | Human | 04/28/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for MAN1A2 Antibody (NBP1-82802)Discover more about diseases related to MAN1A2 Antibody (NBP1-82802).
| Pathways for MAN1A2 Antibody (NBP1-82802)View related products by pathway.
|
PTMs for MAN1A2 Antibody (NBP1-82802)Learn more about PTMs related to MAN1A2 Antibody (NBP1-82802).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: MAN1A2 Antibody [NBP1-82802] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82802-img0008.jpg "Immunocytochemistry/Immunofluorescence: MAN1A2 Antibody [NBP1-82802] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining in human placenta and skeletal muscle tissues. Corresponding MAN1A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0013.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining in human placenta and skeletal muscle tissues. Corresponding MAN1A2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0009.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0010.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0011.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human skeletal muscle shows very weak positivity in myocytes.](http://images.novusbio.com/fullsize2/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0012.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human skeletal muscle shows very weak positivity in myocytes.")
![Immunocytochemistry/Immunofluorescence: ATP8A2 Antibody [NBP2-55197] - Staining of human cell line PC-3 shows localization to plasma membrane.](http://images.novusbio.com/images2/ATP8A2 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55197-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: EDEM1 Antibody [NBP1-84905] - Staining of human cell line RT4 shows localization to aggresome. Antibody staining is shown in green.](http://images.novusbio.com/images2/EDEM1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84905-img0004.jpg)
![Immunohistochemistry-Paraffin: EDEM1 Antibody [NBP1-84905] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/EDEM1 Antibody-Immunohistochemistry-Paraffin-NBP1-84905-img0005.jpg)
![Western Blot: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Analysis in human cell line Jurkat.](http://images.novusbio.com/images2/Arylsulfatase-A-ARSA-Antibody-Western-Blot-NBP1-86135-img0005.jpg)
![Immunohistochemistry-Paraffin: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Arylsulfatase-A-ARSA-Antibody-Immunohistochemistry-Paraffin-NBP1-86135-img0013.jpg)
![Immunohistochemistry-Paraffin: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Analysis in human testis and skeletal muscle tissues. Corresponding ARSA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Arylsulfatase-A-ARSA-Antibody-Immunohistochemistry-Paraffin-NBP1-86135-img0006.jpg)
![Western Blot: MNS1 Antibody [NBP1-83764] - Analysis in control (vector only transfected HEK293T lysate) and MNS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/MNS1 Antibody-Western Blot-NBP1-83764-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MNS1 Antibody [NBP1-83764] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/images2/MNS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83764-img0005.jpg)
![Immunohistochemistry-Paraffin: MNS1 Antibody [NBP1-83764] - Staining of human testis shows moderate positivity in seminiferous ducts.](http://images.novusbio.com/images2/MNS1-Antibody-Immunohistochemistry-Paraffin-NBP1-83764-img0004.jpg)
![Simple Western: GRP78/HSPA5 Antibody [NBP1-06274] - Image shows a specific band for GRP78 in 0.1 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/GRP78-HSPA5-Antibody-Simple-Western-NBP1-06274-img0006.jpg)
![Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - C. elegans granulins impair organismal fitness and resistance to ER stress. Total worm lysates from synchronized day 1 adult granulin-expressing animals were immunoblotted with an anti-GRP78/HSPA5 antibody (3 biological replicates). Anti-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1008295), licensed under a CC-BY licence.](http://images.novusbio.com/images2/GRP78-HSPA5-Antibody-Western-Blot-NBP1-06274-img0016.jpg)
![Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Analysis of MAM-associated protein levels in control and patients' fibroblasts.(A) Equal amounts from one control and the five patients were loaded (50 ug of total cell lysates) and subjected to Western Blot with anti-Grp75, anti-sigma-1R and anti-Mfn2 antibodies. We used anti-GAPDH antibody to ensure equal amounts of protein loaded in each lane. This result is representative of three independent experiments. PLoS One. 2016 Mar 9;11(3):e0150357. doi: 10.1371/journal.pone.0150357](http://images.novusbio.com/images2/GRP78-HSPA5-Antibody-Western-Blot-NBP1-06274-img0017.jpg)
![Immunohistochemistry-Paraffin: EDEM3 Antibody [NBP1-88341] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/EDEM3-Antibody-Immunohistochemistry-Paraffin-NBP1-88341-img0005.jpg)
![Immunohistochemistry-Paraffin: EDEM3 Antibody [NBP1-88341] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/EDEM3-Antibody-Immunohistochemistry-Paraffin-NBP1-88341-img0004.jpg)
![Immunohistochemistry-Paraffin: EDEM3 Antibody [NBP1-88341] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/images2/EDEM3 Antibody-Immunohistochemistry-Paraffin-NBP1-88341-img0006.jpg)
![Western Blot: Ribophorin I Antibody (OTI3H3) [NBP2-01294] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Ribophorin I (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Ribophorin I.](http://images.novusbio.com/images2/Ribophorin-I-Antibody-(OTI3H3)-Western-Blot-NBP2-01294-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: Ribophorin I Antibody (OTI3H3) [NBP2-01294] - expression of RPN1 on pca cell lines vs normal. Image from verified customer review.](http://images.novusbio.com/images2/Ribophorin-I-Antibody-(OTI3H3)-Immunocytochemistry-Immunofluorescence-NBP2-01294-img0010.jpg)
![Immunohistochemistry: Ribophorin I Antibody (OTI3H3) [NBP2-01294] - Staining of paraffin-embedded Human pancreas tissue using anti-Ribophorin I mouse monoclonal antibody.](http://images.novusbio.com/images2/Ribophorin-I-Antibody-(OTI3H3)-Immunohistochemistry-NBP2-01294-img0018.jpg)
![Western Blot: RER1 Antibody [NBP1-59953] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/RER1-Antibody-Western-Blot-NBP1-59953-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: RER1 Antibody [NBP1-59953] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution; Primary Antibody Concentration: 1:100](http://images.novusbio.com/images2/RER1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59953-img0003.jpg)
![Knockdown Validated: OS9 Antibody [NB100-519] - Contribution and interaction of OS-9 for degradation of SHH proteins. Cells stably expressing the N278A-HA precursor were depleted of OS-9 by siRNA, and the fate of N278A was followed after cycloheximide (CHX) addition. All samples were analyzed by SDS-PAGE and immunoblotting with HA antibodies. Controls were treated with a commercial negative control siRNA. The samples were also immunoblotted for OS-9 to show the extent of depletion. Immunoblotting with GAPDH antibodies served as loading control. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092164) licensed under a CC-BY licence.](http://images.novusbio.com/images2/OS9-Antibody-Knockdown-Validated-NB100-519-img0010.jpg)
![Western Blot: OS9 Antibody [NB100-519] - Detection of OS-9.1 and OS-9.2 in total HEK293 cells, HEK293 cells expressing OS-9.1 or OS-9.2 by western analysis.](http://images.novusbio.com/images2/OS9 Antibody-Western Blot-NB100-519-img0005.jpg)
![Immunohistochemistry: OS9 Antibody [NB100-519] - Staining of OS9 in mouse smooth muscle.](http://images.novusbio.com/images2/OS9 Antibody-Immunohistochemistry-NB100-519-img0009.jpg)
![Western Blot: alpha 1 Mannosidase 1A Antibody [NB600-977] - Whole extract of HepG2 cells was separated on SDS-PAGE and probed with 0.5 ug/mL Rabbit Anti-a1,2-Mannosidase IA. The antibody was developed using Goat Anti-Rabbit IgG-Peroxidase and a chemiluminescent substrate.](http://images.novusbio.com/images2/alpha-1-Mannosidase-1A-Antibody-Western-Blot-NB600-977-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NB600-977] - HepG2 cells were fixed and permeabilized with cold methanol followed by cold methanol:acetone (1:1). Fixed cells were stained with 10 ug/mL Rabbit Anti-a1,2-Mannosidase IA. The antibody was developed using Goat Anti-Rabbit IgG, Cy3 conjugate.](http://images.novusbio.com/images2/alpha 1 Mannosidase 1A Antibody-Immunocytochemistry-Immunofluorescence-NB600-977-img0010.jpg)
![Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NB600-977] - Anti-a 1,2-Mannosidase IA: Immunoperoxidase staining of Anti-a 1,2-Mannosidase IA in formalin fixed, paraffin-embedded mouse kidney at 0.4 ug/mL.](http://images.novusbio.com/images2/alpha 1 Mannosidase 1A Antibody-Immunohistochemistry-NB600-977-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: UGT Antibody [NBP1-80642] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/images2/UGT Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80642-img0004.jpg)
![Immunohistochemistry-Paraffin: UGT Antibody [NBP1-80642] - Staining of human rectum shows strong cytoplasmic staining and additional nuclear membrane positivity in glandular cells.](http://images.novusbio.com/images2/UGT-Antibody-Immunohistochemistry-Paraffin-NBP1-80642-img0002.jpg)
![Western Blot: ERLEC1 Antibody [NBP1-86802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/images2/ERLEC1-Antibody-Western-Blot-NBP1-86802-img0005.jpg)
![Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86802] - Staining of human testis.](http://images.novusbio.com/images2/ERLEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86802-img0009.jpg)
![Western Blot: ERLEC1 Antibody [NBP1-86802] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/ERLEC1-Antibody-Western-Blot-NBP1-86802-img0004.jpg)
![Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/images2/Protamine-1-Antibody-Immunohistochemistry-Paraffin-NBP2-30949-img0009.jpg)
![Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.](http://images.novusbio.com/images2/Protamine-1-Antibody-Immunohistochemistry-Paraffin-NBP2-30949-img0004.jpg)
![Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/images2/Protamine-1-Antibody-Immunohistochemistry-Paraffin-NBP2-30949-img0006.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")