SUR-8 Antibody

Images

 
Western Blot: SUR-8 Antibody [NBP1-87831] - Analysis in human cell line T-47d.
Immunocytochemistry/ Immunofluorescence: SUR-8 Antibody [NBP1-87831] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western Blot: SUR-8 Antibody [NBP1-87831] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human testis shows moderate cytoplasmic and stronger nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUR-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Specificity
Specificity of human, mouse, rat SUR-8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHOC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUR-8 Protein (NBP1-87831PEP)
Publications
Read Publication using NBP1-87831.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUR-8 Antibody

  • KIAA0862FLJ60412
  • Protein soc-2 homolog
  • Protein sur-8 homolog
  • SIAA0862
  • soc-2 (suppressor of clear, C.elegans) homolog
  • soc-2 suppressor of clear homolog (C. elegans)
  • SOC-2
  • SOC2SUR8leucine-rich repeat protein SHOC-2
  • SUR-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-47668
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67791
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-87831
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUR-8 Antibody (NBP1-87831)(1)

Reviews for SUR-8 Antibody (NBP1-87831) (0)

There are no reviews for SUR-8 Antibody (NBP1-87831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUR-8 Antibody (NBP1-87831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUR-8 Products

Bioinformatics Tool for SUR-8 Antibody (NBP1-87831)

Discover related pathways, diseases and genes to SUR-8 Antibody (NBP1-87831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUR-8 Antibody (NBP1-87831)

Discover more about diseases related to SUR-8 Antibody (NBP1-87831).
 

Pathways for SUR-8 Antibody (NBP1-87831)

View related products by pathway.

PTMs for SUR-8 Antibody (NBP1-87831)

Learn more about PTMs related to SUR-8 Antibody (NBP1-87831).
 

Research Areas for SUR-8 Antibody (NBP1-87831)

Find related products by research area.

Blogs on SUR-8

There are no specific blogs for SUR-8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUR-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHOC2