Home » SUR-8 » SUR-8 Antibodies » SUR-8 Antibody

SUR-8 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SUR-8 Antibody [NBP1-87831] - Analysis in human cell line T-47d.
Western Blot: SUR-8 Antibody [NBP1-87831] - Analysis in human cell line T-47d.
Immunocytochemistry/ Immunofluorescence: SUR-8 Antibody [NBP1-87831] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western Blot: SUR-8 Antibody [NBP1-87831] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human testis shows moderate cytoplasmic and stronger nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SUR-8 Antibody [NBP1-87831] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SUR-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Specificity
Specificity of human, mouse, rat SUR-8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHOC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUR-8 Protein (NBP1-87831PEP)
Publications
Read Publication using NBP1-87831.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUR-8 Antibody

  • KIAA0862FLJ60412
  • Protein soc-2 homolog
  • Protein sur-8 homolog
  • SIAA0862
  • soc-2 (suppressor of clear, C.elegans) homolog
  • soc-2 suppressor of clear homolog (C. elegans)
  • SOC-2
  • SOC2SUR8leucine-rich repeat protein SHOC-2
  • SUR-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
MEK1 Antibody
(SZ22-01)
NBP2-67358
Western Blot: MEK1 Antibody (SZ22-01) [NBP2-67358] - Whole cell lysates (30 ug per lane) from three different hematological cancer cell lines. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: MEK1 Antibody (SZ22-01) [NBP2-67358] - Analysis of paraffin-embedded mouse uterus tissue using anti-MEK1 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: WB, ICC/IF
SHP-2/PTPN11
Antibody (6D9)
NBP2-37454
Western Blot: SHP-2/PTPN11 Antibody (6D9) [NBP2-37454] - Analysis using PTPN11 mAb against human PTPN11 recombinant protein. (Expected MW is 33.4 kDa)
Immunocytochemistry/Immunofluorescence: SHP-2/PTPN11 Antibody (6D9) [NBP2-37454] - Analysis of HeLa cells using PTPN11 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: SHP-2/PTPN11 Antibody (6D9) [NBP2-37454] - Analysis of breast cancer tissues using PTPN11 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
B-Raf Antibody
(OTI5A9)
NBP1-47668
Western Blot: B-Raf Antibody (OTI5A9) [NBP1-47668] - Analysis of extracts (35ug) from 9 different cell lines by using anti-B Raf monoclonal antibody.
Immunocytochemistry/Immunofluorescence: B-Raf Antibody (OTI5A9) [NBP1-47668] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY B Raf.
Immunohistochemistry-Paraffin: B-Raf Antibody (OTI5A9) [NBP1-47668] - Staining of paraffin-embedded Human pancreas tissue using anti-B Raf mouse monoclonal antibody.
(1 Publication)
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Recombinant Human
NRAS Protein
NBP1-41158
SDS-Page: Recombinant Human NRAS Protein [NBP1-41158]
(1 Publication)
Species: Hu
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(468 Publications)
Species: Hu
MEK2 Antibody
(SD207-08)
NBP2-67791
Western Blot: MEK2 Antibody (SD207-08) [NBP2-67791] - Analysis of MEK2 on different lysates using anti-MEK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Jurkat Lane 2: Hela Lane 3: 293T
Immunocytochemistry/Immunofluorescence: MEK2 Antibody (SD207-08) [NBP2-67791] - Staining MEK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MEK2 Antibody (SD207-08) [NBP2-67791] - Analysis of paraffin-embedded mouse lung tissue using anti-MEK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ZHX2 Antibody
NBP1-82956
Western Blot: ZHX2 Antibody [NBP1-82956] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-651
Immunocytochemistry/Immunofluorescence: ZHX2 Antibody [NBP1-82956] - Staining of human cell line REH shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82956] - Staining of human cerebral cortex.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(374 Publications)
Species: Hu
HRAS Antibody
(OTI1D9)
NBP2-45745
Western Blot: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY vH RAS.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
CBL Antibody (3B12)
NBP2-37574
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
Immunocytochemistry/Immunofluorescence: CBL Antibody (3B12) [NBP2-37574] - Immunofluorescence analysis of Hela cells using C-CBL mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: CBL Antibody (3B12) [NBP2-37574] - Analysis of cancer tissues using C-CBL mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Nucleostemin
Antibody [Unconjugate
AF1638
Nucleostemin was detected in immersion fixed U2OS human osteosarcoma cell line using 10 µg/mL Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Nucleostemin at approximately 83 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC‑3 human prostate cancer cell line and SW480 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nucleostemin at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
CENPJ Antibody
(1A5)
H00055835-M02
Western Blot: CENPJ Antibody (1A5) [H00055835-M02] - Analysis of CENPJ expression in transfected 293T cell line by CENPJ monoclonal antibody (M02), clone 1A5.Lane 1: CENPJ transfected lysate(43.2 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: CENPJ Antibody (1A5) [H00055835-M02] - Analysis of CENPJ transfected lysate using anti-CENPJ monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CENPJ MaxPab rabbit polyclonal antibody.
Sandwich ELISA: CENPJ Antibody (1A5) [H00055835-M02] - Detection limit for recombinant GST tagged CENPJ is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
SUR-8 Antibody
NBP1-87831
SUR-8 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUR-8 Antibody (NBP1-87831)(1)


Reviews for SUR-8 Antibody (NBP1-87831) (0)

There are no reviews for SUR-8 Antibody (NBP1-87831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUR-8 Antibody (NBP1-87831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SUR-8 Products

Bioinformatics Tool for SUR-8 Antibody (NBP1-87831)

Discover related pathways, diseases and genes to SUR-8 Antibody (NBP1-87831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUR-8 Antibody (NBP1-87831)

Discover more about diseases related to SUR-8 Antibody (NBP1-87831).
 

Pathways for SUR-8 Antibody (NBP1-87831)

View related products by pathway.

PTMs for SUR-8 Antibody (NBP1-87831)

Learn more about PTMs related to SUR-8 Antibody (NBP1-87831).
 

Research Areas for SUR-8 Antibody (NBP1-87831)

Find related products by research area.

Blogs on SUR-8

There are no specific blogs for SUR-8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUR-8 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SHOC2