TCFL5 Antibody - BSA Free

Western Blot: TCFL5 Antibody [NBP2-49174] - Analysis in human cell line MOLT-4.

Immunocytochemistry/Immunofluorescence: TCFL5 Antibody [NBP2-49174] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human liver shows no positivity in hepatocytes as expected.

Western Blot: TCFL5 Antibody [NBP2-49174] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Analysis in human testis and pancreas tissues. Corresponding TCFL5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human rectum shows weak to moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCFL5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCFL5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TCFL5 Recombinant Protein Antigen (NBP2-49174PEP)

Reactivity Notes

Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TCFL5 Antibody - BSA Free

• bHLHe82
• Cha transcription factor
• CHA
• CHAMGC46135
• E2BP1
• E2BP-1HPV-16 E2 binding protein 1
• Figlb
• HPV-16 E2-binding protein 1
• transcription factor-like 5 (basic helix-loop-helix)
• transcription factor-like 5 protein

Background

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCFL5