ALG12 Antibody

Images

 
Immunohistochemistry-Paraffin: ALG12 Antibody [NBP2-14282] - Staining of human kidney shows strong granular cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDV QPGTGMLAYTHILMEAAPGLLALYRDTHRVLASVVGTTGVSLNLTQLPPF NVHLQTKLVLLERL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH6 antigen retrieval is recommended.
Control Peptide
ALG12 Protein (NBP2-14282PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG12 Antibody

  • alpha-1,6-mannosyltransferase)
  • asparagine-linked glycosylation 12 homolog (S. cerevisiae
  • asparagine-linked glycosylation 12 homolog (yeast
  • asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 12 homolog
  • CDG1G
  • dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase
  • dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase
  • EC 2.4.1.-
  • ECM39
  • hALG12
  • Mannosyltransferase ALG12 homolog
  • Membrane protein SB87
  • MGC111358
  • MGC3136
  • PP14673

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13407
Species: Hu
Applications: IHC, IHC-P
NBP2-57753
Species: Hu
Applications: WB, ICC/IF
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83798
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3686
Species: Mu
Applications: WB
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00022845-G01-10ug
Species: Hu
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-32394
Species: Hu
Applications: IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready

Publications for ALG12 Antibody (NBP2-14282) (0)

There are no publications for ALG12 Antibody (NBP2-14282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG12 Antibody (NBP2-14282) (0)

There are no reviews for ALG12 Antibody (NBP2-14282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALG12 Antibody (NBP2-14282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG12 Products

Bioinformatics Tool for ALG12 Antibody (NBP2-14282)

Discover related pathways, diseases and genes to ALG12 Antibody (NBP2-14282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG12 Antibody (NBP2-14282)

Discover more about diseases related to ALG12 Antibody (NBP2-14282).
 

Pathways for ALG12 Antibody (NBP2-14282)

View related products by pathway.

PTMs for ALG12 Antibody (NBP2-14282)

Learn more about PTMs related to ALG12 Antibody (NBP2-14282).

Blogs on ALG12

There are no specific blogs for ALG12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG12
Entrez
Uniprot