PIGB Antibody - BSA Free

Staining of human thyroid gland shows moderate nuclear and cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIGB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PIGB Protein (NBP1-85856PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIGB Antibody - BSA Free

• EC 2.4.1
• EC 2.4.1.-
• GPI mannosyltransferase 3
• GPI mannosyltransferase III
• GPI-MT-III
• MGC21236
• phosphatidylinositol glycan anchor biosynthesis, class B
• phosphatidylinositol glycan, class B
• Phosphatidylinositol-glycan biosynthesis class B protein
• PIG-B

Background

PIGB, also referred to as GPI mannosyltransferase 3, is 554 amino acids long and is approximately 65 kDa. PIGB is a mannosyltransferase that is implicated in the biosynthesis of GPI anchors. Current research on PIGB is being performed relating to several diseases and disorders including malaria, sleeping sickness, Griscelli syndrome and encephalomalacia. PIGB has also been shown to have interactions with TMED10, CDC40, DNAJA1, FNBP1L and EEF1A1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGB