PIGB Antibody

Images

 
Western Blot: PIGB Antibody [NBP1-85856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PIGB Antibody [NBP1-85856] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
Western Blot: PIGB Antibody [NBP1-85856] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGB Protein (NBP1-85856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGB Antibody

  • EC 2.4.1
  • EC 2.4.1.-
  • GPI mannosyltransferase 3
  • GPI mannosyltransferase III
  • GPI-MT-III
  • MGC21236
  • phosphatidylinositol glycan anchor biosynthesis, class B
  • phosphatidylinositol glycan, class B
  • Phosphatidylinositol-glycan biosynthesis class B protein
  • PIG-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-32394
Species: Hu
Applications: IHC, IHC-P
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP1-62449
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13761
Species: Hu
Applications: IHC, IHC-P
NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5430
Species: Mu
Applications: WB, IP
NBP1-86283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31564
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69261
Species: Hu
Applications: WB, IHC
NBP1-62435
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIGB Antibody (NBP1-85856) (0)

There are no publications for PIGB Antibody (NBP1-85856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGB Antibody (NBP1-85856) (0)

There are no reviews for PIGB Antibody (NBP1-85856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGB Antibody (NBP1-85856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGB Products

Bioinformatics Tool for PIGB Antibody (NBP1-85856)

Discover related pathways, diseases and genes to PIGB Antibody (NBP1-85856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGB Antibody (NBP1-85856)

Discover more about diseases related to PIGB Antibody (NBP1-85856).
 

Pathways for PIGB Antibody (NBP1-85856)

View related products by pathway.

PTMs for PIGB Antibody (NBP1-85856)

Learn more about PTMs related to PIGB Antibody (NBP1-85856).

Blogs on PIGB

There are no specific blogs for PIGB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGB