ALG9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALG9 Antibody [NBP1-90191] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: ALG9 Antibody [NBP1-90191] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALG9 Protein (NBP1-90191PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG9 Antibody

  • alpha-1,2-mannosyltransferase ALG9
  • asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha-1,2-mannosyltransferase)
  • asparagine-linked glycosylation 9 homolog (yeast, alpha 1,2mannosyltransferase)
  • asparagine-linked glycosylation 9 homolog (yeast, alpha-1,2-mannosyltransferase)
  • asparagine-linked glycosylation 9, alpha- 1,2-mannosyltransferase homolog (S.cerevisiae, alpha- 1,2-mannosyltransferase)
  • asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 9 homolog
  • CDG1L
  • DIBD1FLJ21845
  • disrupted in bipolar affective disorder 1
  • Disrupted in bipolar disorder protein 1
  • DKFZp586M2420
  • EC 2.4.1.-
  • LOH11CR1J
  • loss of heterozygosity, 11, chromosomal region 1 gene J product

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079087-M06
Species: Hu, Rt
Applications: WB, ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21008
Species: Hu
Applications: WB
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-46439
Species: Hu
Applications: WB, IHC
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83798
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-62494
Species: Hu
Applications: WB
NBP2-13407
Species: Hu
Applications: IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-32394
Species: Hu
Applications: IHC, IHC-P
AF198
Species: Mu
Applications: WB, IHC
NBP1-91658
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALG9 Antibody (NBP1-90191) (0)

There are no publications for ALG9 Antibody (NBP1-90191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG9 Antibody (NBP1-90191) (0)

There are no reviews for ALG9 Antibody (NBP1-90191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALG9 Antibody (NBP1-90191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG9 Products

ALG9 NBP1-90191

Bioinformatics Tool for ALG9 Antibody (NBP1-90191)

Discover related pathways, diseases and genes to ALG9 Antibody (NBP1-90191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG9 Antibody (NBP1-90191)

Discover more about diseases related to ALG9 Antibody (NBP1-90191).
 

Pathways for ALG9 Antibody (NBP1-90191)

View related products by pathway.

PTMs for ALG9 Antibody (NBP1-90191)

Learn more about PTMs related to ALG9 Antibody (NBP1-90191).

Blogs on ALG9

There are no specific blogs for ALG9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG9