VPS53 Antibody

Images

 
Western Blot: VPS53 Antibody [NBP1-83798] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: VPS53 Antibody [NBP1-83798] - Staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: VPS53 Antibody [NBP1-83798] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: VPS53 Antibody [NBP1-83798] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS53 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS53
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS53 Protein (NBP1-83798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS53 Antibody

  • FLJ10979
  • FLJ41112
  • FLJ61757
  • HCCS1
  • hVps53L
  • MGC39512
  • pp13624
  • vacuolar protein sorting 53 (yeast)
  • vacuolar protein sorting 53 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 53 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30418
Species: Hu
Applications: IHC, IHC-P
NBP2-57268
Species: Hu
Applications: WB, ICC/IF
NBP2-24664
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-84423
Species: Hu
Applications: IHC, IHC-P
H00022876-B01P
Species: Hu
Applications: WB, ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56070
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90857
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-91868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P

Publications for VPS53 Antibody (NBP1-83798) (0)

There are no publications for VPS53 Antibody (NBP1-83798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS53 Antibody (NBP1-83798) (0)

There are no reviews for VPS53 Antibody (NBP1-83798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS53 Antibody (NBP1-83798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS53 Products

Bioinformatics Tool for VPS53 Antibody (NBP1-83798)

Discover related pathways, diseases and genes to VPS53 Antibody (NBP1-83798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS53 Antibody (NBP1-83798)

Discover more about diseases related to VPS53 Antibody (NBP1-83798).
 

Pathways for VPS53 Antibody (NBP1-83798)

View related products by pathway.

PTMs for VPS53 Antibody (NBP1-83798)

Learn more about PTMs related to VPS53 Antibody (NBP1-83798).

Blogs on VPS53

There are no specific blogs for VPS53, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS53 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS53