Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody

Western Blot: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Analysis in human cell lines A-549 and A-431 using anti-ALDH1A1 antibody. Corresponding ALDH1A1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunocytochemistry/Immunofluorescence: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human tonsil shows very weak positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
• Marker: Astrocyte Marker
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH1A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23335266)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody

• acetaldehyde dehydrogenase 1
• ALDC
• aldehyde dehydrogenase 1 family, member A1
• aldehyde dehydrogenase 1, soluble
• Aldehyde Dehydrogenase 1A1
• Aldehyde Dehydrogenase 1-A1
• Aldehyde dehydrogenase family 1 member A1
• Aldehyde dehydrogenase, cytosolic
• aldehyde dehydrogenase, liver cytosolic
• ALDH class 1
• ALDH1
• ALDH11
• ALDH1A1
• ALDH-E1
• ALHDII
• EC 1.2.1
• EC 1.2.1.36
• MGC2318
• PUMB1
• RALDH 1
• RALDH1
• retinal dehydrogenase 1
• retinaldehyde dehydrogenase 1

Background

Usual human livers contain two major ALDH isozymes, i.e., cytosolic ALDH1 and mitochondrial ALDH2(1). Human red cell aldehyde dehydrogenase (ALDH) resembles the liver cytosolic isozyme in numerous physicochemical properties. Thus, the erythrocyte enzyme, by virtue of its chemical and structural identity with the liver cytosolic enzyme, may serve as a suitable peripheral enzyme model to understand the cause and mechanism of alcohol abuse-related changes in liver cytosolic ALDH that has been found to be reduced in alcoholics (2). ALDH1A1 is known to catalyze the oxidation of retinaldehyde to retinoic acid. Overexpression of human ALDH1A1 in HEK cells led to a more than 20-fold increase in 3-deoxyglucosone dehydrogenase activity (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)(4)

Publications using NBP1-89152

• Huang R, Yamamoto T, Nakata E et al. CDKAL1 Drives the Maintenance of Cancer Stem-Like Cells by Assembling the eIF4F Translation Initiation Complex Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2023-02-14 [PMID: 36786012] (WB)
• Chefetz I, Grimley E, Yang K et al. A Pan-ALDH1A Inhibitor Induces Necroptosis in Ovarian Cancer Stem-like Cells Cell Rep 2019-03-12 [PMID: 30865894] (WB, Human)
• Harper AR, Wiechmann AF, Moiseyev G et al. Identification of Active Retinaldehyde Dehydrogenase Isoforms in the Postnatal Human Eye. PLoS One 2015-01-01 [PMID: 25793304] (IF/IHC, Human)
• Szabo AZ, Fong S, Yue L et al. The CD44+ALDH+ Population of Human Keratinocytes Is Enriched for Epidermal Stem Cells with Long-Term Repopulating Ability. Stem Cells 2013-04-01 [PMID: 23335266]

Bioinformatics

• Gene Symbol: ALDH1A1