Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody

Images

 
Western Blot: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [NBP1-89152] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
Marker
Astrocyte Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH1A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aldehyde Dehydrogenase 1-A1/ALDH1A1 Protein (NBP1-89152PEP)
Publications
Read Publications using
NBP1-89152 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23335266)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody

  • acetaldehyde dehydrogenase 1
  • ALDC
  • aldehyde dehydrogenase 1 family, member A1
  • aldehyde dehydrogenase 1, soluble
  • Aldehyde Dehydrogenase 1A1
  • Aldehyde Dehydrogenase 1-A1
  • Aldehyde dehydrogenase family 1 member A1
  • Aldehyde dehydrogenase, cytosolic
  • aldehyde dehydrogenase, liver cytosolic
  • ALDH class 1
  • ALDH1
  • ALDH11
  • ALDH1A1
  • ALDH-E1
  • ALHDII
  • EC 1.2.1
  • EC 1.2.1.36
  • MGC2318
  • PUMB1
  • RALDH 1
  • RALDH1
  • retinal dehydrogenase 1
  • retinaldehyde dehydrogenase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5248
Species: Hu
Applications: IHC
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00000126-D01P
Species: Hu, Mu
Applications: WB
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152) (0)

There are no reviews for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldehyde Dehydrogenase 1-A1/ALDH1A1 Products

Bioinformatics Tool for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)

Discover related pathways, diseases and genes to Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)

Discover more about diseases related to Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152).
 

Pathways for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)

View related products by pathway.

PTMs for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)

Learn more about PTMs related to Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152).
 

Research Areas for Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody (NBP1-89152)

Find related products by research area.

Blogs on Aldehyde Dehydrogenase 1-A1/ALDH1A1

There are no specific blogs for Aldehyde Dehydrogenase 1-A1/ALDH1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH1A1
Entrez