ALDH1A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining in human endometrium and skin tissues . Corresponding ALDH1A2 RNA-seq data are presented for the same tissues.

Western Blot: ALDH1A2 Antibody [NBP1-87158] - Analysis in human cell line K562.

Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in cells in endometrial stroma.

Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human skin shows weak cytoplasmic positivity in a subset of keratinocytes.

Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Simple Western: ALDH1A2 Antibody [NBP1-87158] - Detection of ALDH1A2 in K562 cells using ALDH1A2 antibody at a dilution of 1:50. K (lane 1) = Wild Type K562, I (lane 2) = Imatinib Resistant K562, N (lane 3) = Nilotinib Resistant K562 and D (lane 4) = Dasatinib Resistant K562. Image submitted by a verified customer review.

Immunohistochemistry of candidate biomarkers in prostate cancer. Representative immunohistochemical staining of ACPP, ADAM9, ALDH1A2, CASR, CCND1, CCPG1, CD34, CD44, CD44v6, CHGA, CHMP1A, EI24, ENO2, GADD45B, HA, HAS2, HES6, HMMR, HOXC6, HYAL1, IGF1, IQCK, MAP4K4, MKI67, PAGE4, PLIN2, PTEN, SIAH2, SMAD4, SOX9, SPP1, SYP, & TP53 from prostate cancer tissue microarrays. Scale bar represents 50 μm. Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-244), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALDH1A2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ALDH1A2 Antibody - BSA Free (NBP1-87158) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-ALDH1A2 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
• Marker: Dorso-temporal Retina Marker
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH1A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: Tested in Wild Type K562 cells, Imatinib Resistant K562 cells, Nilotinib Resistant K562 cells and Dasatinib Resistant K56 cells, separated by Size, antibody dilution of 1:50
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ALDH1A2 Protein (NBP1-87158PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ALDH1A2 Antibody - BSA Free

• aldehyde dehydrogenase 1 family, member A2
• Aldehyde dehydrogenase family 1 member A2
• ALDH 1A2
• ALDH1A2
• EC 1.2.1
• EC 1.2.1.36
• RALDH 2
• RALDH
• RALDH(II)
• RALDH2
• RALDH2MGC26444
• RALDH2-T
• retinal dehydrogenase 2
• Retinaldehyde-specific dehydrogenase type 2

Background

ALDH1A2 belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALDH1A2 Antibody (NBP1-87158)(4)

Publications using NBP1-87158

• Seidensaal K, Nollert A, Feige AH et al. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Mol Cancer 2015-12-03 [PMID: 26634247] (IF/IHC, Human)
• Harper AR, Wiechmann AF, Moiseyev G et al. Identification of Active Retinaldehyde Dehydrogenase Isoforms in the Postnatal Human Eye. PLoS One 2015-01-01 [PMID: 25793304] (WB, IF/IHC, Human)
• Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014-04-05 [PMID: 24708576] (IF/IHC, Human)
• Kostareli E, Holzinger D, Bogatyrova O et al. HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas. J Clin Invest 2013-06-01 [PMID: 23635773]

Review for ALDH1A2 Antibody (NBP1-87158) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer Simple Western Human 08/18/2016

Summary

• Application: Simple Western
• Sample Tested: k562 cells
• Species: Human

FAQs for ALDH1A2 Antibody (NBP1-87158). (Showing 1 - 1 of 1 FAQs).

1. I am looking for an anti-human ALDH1A2 antibody to use for flow cytometry and I’m wondering if anyone has used NBP1-87158 for this purpose?
   • Unfortunately we have not yet investigated the use of product NBP1-87158 in flow cytometry yet. This antibody is validated for use in IHC and ICC, so it is very likely that it would work in flow as well. Since we are not able to cover this application with our guarantee, I can offer you our Innovator's Reward Program.

Bioinformatics

• Gene Symbol: ALDH1A2
• Entrez:
  • 8854(Human)
• Uniprot:
  • O94788(Human)