ALDH1A2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining in human endometrium and skin tissues . Corresponding ALDH1A2 RNA-seq data are presented for the same tissues.
Western Blot: ALDH1A2 Antibody [NBP1-87158] - Analysis in human cell line K562.
Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in cells in endometrial stroma.
Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human skin shows weak cytoplasmic positivity in a subset of keratinocytes.
Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: ALDH1A2 Antibody [NBP1-87158] - Detection of ALDH1A2 in K562 cells using ALDH1A2 antibody at a dilution of 1:50. K (lane 1) = Wild Type K562, I (lane 2) = Imatinib Resistant K562, N (lane 3) = Nilotinib ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ALDH1A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
Marker
Dorso-temporal Retina Marker
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH1A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 26634247). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ALDH1A2 antibody validated for Simple Western from a verified customer review
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALDH1A2 Protein (NBP1-87158PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87158 in the following applications:

Publications
Read Publications using
NBP1-87158 in the following applications:

  • IHC
    3 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23635773)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH1A2 Antibody

  • aldehyde dehydrogenase 1 family, member A2
  • Aldehyde dehydrogenase family 1 member A2
  • ALDH 1A2
  • ALDH1A2
  • EC 1.2.1
  • EC 1.2.1.36
  • RALDH 2
  • RALDH
  • RALDH(II)
  • RALDH2
  • RALDH2MGC26444
  • RALDH2-T
  • retinal dehydrogenase 2
  • Retinaldehyde-specific dehydrogenase type 2

Background

ALDH1A2 belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5869
Species: Hu, Mu
Applications: ICC, IHC, IP, Simple Western, WB
NBP2-15339
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
423-F8
Species: Hu, Mu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
NB100-53810
Species: Hu, Mu
Applications: Flow, IHC, IHC-P, PEP-ELISA
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
314-BP/CF
Species: Hu
Applications: BA, BA
6507-IL/CF
Species: Hu
Applications: BA
AF5928
Species: Hu
Applications: ICC, IHC, WB
NBP1-90232
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
345-FG/CF
Species: Hu
Applications: BA
NBP2-93848
Species: Hu, Mu, Rt
Applications: WB

Publications for ALDH1A2 Antibody (NBP1-87158)(4)

Review for ALDH1A2 Antibody (NBP1-87158) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87158:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western ALDH1A2 NBP1-87158
Enlarge
5
reviewed by:
Anonymous -
Simple Western Human 08/18/2016
View

Summary

ApplicationSimple Western
Sample Testedk562 cells
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH1A2 Antibody (NBP1-87158). (Showing 1 - 1 of 1 FAQs).

  1. I am looking for an anti-human ALDH1A2 antibody to use for flow cytometry and I’m wondering if anyone has used NBP1-87158 for this purpose?
    • Unfortunately we have not yet investigated the use of product NBP1-87158 in flow cytometry yet. This antibody is validated for use in IHC and ICC, so it is very likely that it would work in flow as well. Since we are not able to cover this application with our guarantee, I can offer you our Innovator's Reward Program.

Secondary Antibodies

 

Isotype Controls

Additional ALDH1A2 Products

Bioinformatics Tool for ALDH1A2 Antibody (NBP1-87158)

Discover related pathways, diseases and genes to ALDH1A2 Antibody (NBP1-87158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1A2 Antibody (NBP1-87158)

Discover more about diseases related to ALDH1A2 Antibody (NBP1-87158).
 

Pathways for ALDH1A2 Antibody (NBP1-87158)

View related products by pathway.

PTMs for ALDH1A2 Antibody (NBP1-87158)

Learn more about PTMs related to ALDH1A2 Antibody (NBP1-87158).
 

Research Areas for ALDH1A2 Antibody (NBP1-87158)

Find related products by research area.

Blogs on ALDH1A2

There are no specific blogs for ALDH1A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous -
08/18/2016
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol ALDH1A2
Entrez
Uniprot