ALDH1A2 Antibody

Images

 
Western Blot: ALDH1A2 Antibody [NBP1-87158] - Analysis in human cell line K562.
Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
Simple Western: ALDH1A2 Antibody [NBP1-87158] - Detection of ALDH1A2 in K562 cells using ALDH1A2 antibody at a dilution of 1:50. K (lane 1) = Wild Type K562, I (lane 2) = Imatinib Resistant K562, N (lane 3) = Nilotinib ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH1A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
Marker
Dorso-temporal Retina Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH1A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALDH1A2 Protein (NBP1-87158PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87158 in the following applications:

Publications
Read Publications using
NBP1-87158 in the following applications:

  • IHC
    3 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23635773)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH1A2 Antibody

  • aldehyde dehydrogenase 1 family, member A2
  • Aldehyde dehydrogenase family 1 member A2
  • EC 1.2.1
  • EC 1.2.1.36
  • RALDH 2
  • RALDH(II)
  • RalDH2
  • RALDH2MGC26444
  • RALDH2-T
  • retinal dehydrogenase 2
  • Retinaldehyde-specific dehydrogenase type 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
423-F8/CF
Species: Hu, Mu
H00056603-M01
Species: Hu
Applications: WB, ELISA
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55418
Species: Hu
Applications: ICC/IF

Publications for ALDH1A2 Antibody (NBP1-87158)(4)

Review for ALDH1A2 Antibody (NBP1-87158) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: Simple Western.

Reviews using NBP1-87158:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western ALDH1A2 NBP1-87158
Enlarge
reviewed by:
Anonymous
Simple Western Human 08/18/2016
View

Summary

ApplicationSimple Western
Sample Testedk562 cells
SpeciesHuman

Blocking

Blocking Details-

Primary Anitbody

Dilution Ratio1:50 dilution

Details

Detection NotesWes platform

Comments

CommentsK (lane 1) = Wild Type K562I (lane 2) = Imatinib Resistant K562 N (lane 3) = Nilotinib Resistant K562D (lane 4) = Dasatinib Resistant K562

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH1A2 Antibody (NBP1-87158). (Showing 1 - 1 of 1 FAQs).

  1. I am looking for an anti-human ALDH1A2 antibody to use for flow cytometry and I’m wondering if anyone has used NBP1-87158 for this purpose?
    • Unfortunately we have not yet investigated the use of product NBP1-87158 in flow cytometry yet. This antibody is validated for use in IHC and ICC, so it is very likely that it would work in flow as well. Since we are not able to cover this application with our guarantee, I can offer you our Innovator's Reward Program.

Secondary Antibodies

 

Isotype Controls

Additional ALDH1A2 Products

Bioinformatics Tool for ALDH1A2 Antibody (NBP1-87158)

Discover related pathways, diseases and genes to ALDH1A2 Antibody (NBP1-87158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1A2 Antibody (NBP1-87158)

Discover more about diseases related to ALDH1A2 Antibody (NBP1-87158).
 

Pathways for ALDH1A2 Antibody (NBP1-87158)

View related products by pathway.

PTMs for ALDH1A2 Antibody (NBP1-87158)

Learn more about PTMs related to ALDH1A2 Antibody (NBP1-87158).

Blogs on ALDH1A2

There are no specific blogs for ALDH1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
08/18/2016
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol ALDH1A2
Entrez
Uniprot