AKR1B1 Recombinant Protein Antigen

Images

 
There are currently no images for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AKR1B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKR1B1.

Source: E. coli

Amino Acid Sequence: VTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKR1B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56910.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AKR1B1 Recombinant Protein Antigen

  • ADR
  • Aldehyde reductase
  • Aldo-keto reductase family 1 member B1
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • ALDR1aldose reductase
  • ALR2
  • ARaldehyde reductase 1
  • EC 1.1.1
  • EC 1.1.1.21
  • Lii5-2 CTCL tumor antigen
  • low Km aldose reductase
  • MGC1804

Background

Aldose reductase (also designated AKR1B1, ALDR1, ALR2 or AR) is member of the monomeric NADPH-dependent aldoketoreductase family. Aldose reductase, which has a molecular mass of 36 kDa, catalyzes the reduction of various aldehydes and has been implicated in the development of diabetic complications by catalyzing the reduction of the aldehyde form of glucose, to the corresponding sugar alcohol, sorbitol. This pathway plays a minor role in glucose metabolism in most tissues, however in diabetic hyperglycemia, cells undergoing insulin-independent uptake of glucose accumulate significant quantities of sorbitol. The resulting hyperosmotic stress to cells may be a cause of diabetic complications such as neuropathy, retinopathy, and cataracts. Aldose reductase is very similar to human aldehyde reductase, bovine prostaglandin F synthase and to the European common frog protein, rho-crystallin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-90233
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-35880
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-62658
Species: Hu
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY413
Species: Mu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP1-87416
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB

Publications for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP) (0)

There are no publications for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP) (0)

There are no reviews for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKR1B1 Products

Research Areas for AKR1B1 Recombinant Protein Antigen (NBP2-56910PEP)

Find related products by research area.

Blogs on AKR1B1

There are no specific blogs for AKR1B1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AKR1B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1B1