AGPAT6 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: FAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESW |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AGPAT6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for AGPAT6 Antibody - BSA Free
Background
Glycerol-3-phosphate acyltransferase 4 (GPAT4), also known as AGPAT6, is a novel glycerolipid acyltransferase of the ER, which is crucial for the production of milk fat by the mammary gland.
Agpat6 deficiency leads to a reduction in body weight and resistance to both diet-induced and genetically induced obesity. This reduced body weight is associated with increased energy expenditure, reduced triglyceride accumulation in BAT and WAT, reduced white adipocyte size, and lack of adipose tissue in the subdermal region. AGPAT6 fills a unique role in determining triglyceride content and composition in adipose tissue and liver that cannot be compensated by other members of the Agpat family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Publications for AGPAT6 Antibody (NBP1-85061) (0)
There are no publications for AGPAT6 Antibody (NBP1-85061).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AGPAT6 Antibody (NBP1-85061) (0)
There are no reviews for AGPAT6 Antibody (NBP1-85061).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for AGPAT6 Antibody (NBP1-85061) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AGPAT6 Products
Research Areas for AGPAT6 Antibody (NBP1-85061)
Find related products by research area.
|
Blogs on AGPAT6