AGPAT9 Antibody - BSA Free

Immunohistochemistry-Paraffin: AGPAT9 Antibody [NBP1-93692] - Staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells in the suprabasal layer.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGPAT9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AGPAT9 Antibody - BSA Free (NBP1-93692) is a polyclonal antibody validated for use in IHC and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN
• Predicted Species: Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPAT3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:100
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  AGPAT9 Protein (NBP1-93692PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AGPAT9 Antibody - BSA Free

• 1-acylglycerol-3-phosphate O-acyltransferase 9
• acyl-CoA:glycerol-3-phosphate acyltransferase 3
• glycerol-3-phosphate acyltransferase 3
• GPAT3
• GPAT-3,1-acylglycerol-3-phosphate O-acyltransferase 8
• hGPAT3
• HMFN0839,1-AGP acyltransferase 9
• lysophosphatidic acid acyltransferase theta
• MAG1
• MAG-1
• MGC11324
• theta
• UNQ2753/PRO6492

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPAT3
• Entrez:
  • 84803(Human)
• Uniprot:
  • Q53EU6(Human)