AF10 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit AF10 Antibody - BSA Free (NBP3-25268) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein AF10 using the following amino acid sequence: IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MLLT10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 µg/ml
|
| Application Notes |
For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for AF10 Antibody - BSA Free
Background
AF10 is a putative transcription factor containing a leucine zipper motif. A t(10;11)(p12;q23) chromosomal translocation present in a proportion of acute myeloid leukaemias results in expression of an AF10 (carboxy terminus) MLL (amino terminus) fusion protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Fe, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC
Publications for AF10 Antibody (NBP3-25268) (0)
There are no publications for AF10 Antibody (NBP3-25268).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AF10 Antibody (NBP3-25268) (0)
There are no reviews for AF10 Antibody (NBP3-25268).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AF10 Antibody (NBP3-25268) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AF10 Products
Blogs on AF10