BRPF1 Antibody - BSA Free

Analysis in human testis and liver tissues using HPA003359 antibody. Corresponding BRPF1 RNA-seq data are presented for the same tissues.

Staining of human testis shows strong nuclear-cytoplasmic positivity in cells in seminiferous ducts.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human skin shows strong nuclear-cytoplasmic positivity in squamous epithelial cells.

Staining of human placenta shows strong nuclear-cytoplasmic positivity in trophoblastic cells.

Staining of human cerebellum shows strong nuclear positivity in molecular layer and moderate cytoplasmic positivity in purkinje cells.

ChIP-Exo-Seq composite graph for Anti-BRPF1 (NBP1-88369) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRPF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BRPF1 Antibody - BSA Free (NBP1-88369) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRPF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BRPF1 Protein (NBP1-88369PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BRPF1 Antibody - BSA Free

• BR140
• bromodomain and PHD finger containing, 1
• Bromodomain and PHD finger-containing protein 1
• BRPF1
• peregrin
• Protein Br140

Background

BRPF1 is encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRPF1