ADCK4 Antibody - BSA Free

Western Blot: ADCK4 Antibody [NBP1-85509] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: ADCK4 Antibody [NBP1-85509] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Western Blot: ADCK4 Antibody [NBP1-85509] - Analysis in control (vector only transfected HEK293T lysate) and ADCK4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADCK4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADCK4 Antibody - BSA Free (NBP1-85509) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRI
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COQ8B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ADCK4 Protein (NBP1-85509PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADCK4 Antibody - BSA Free

• aarF domain containing kinase 4
• COQ8
• EC 2.7.11
• EC 2.7.11.-
• EC 2.7.11.1
• EC 2.7.11.25
• FLJ12229

Background

The function of this protein is not yet clear. It is not known if it has protein kinase activity and whattype of substrate it would phosphorylate (Ser, Thr or Tyr)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COQ8B