ADCK4 Antibody

Images

 
Western Blot: ADCK4 Antibody [NBP1-85509] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: ADCK4 Antibody [NBP1-85509] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADCK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADCK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADCK4 Protein (NBP1-85509PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADCK4 Antibody

  • aarF domain containing kinase 4
  • COQ8
  • EC 2.7.11
  • EC 2.7.11.-
  • EC 2.7.11.1
  • EC 2.7.11.25
  • FLJ12229

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5277
Species: Hu
Applications: WB, IHC
NBP1-84929
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
H00001846-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-14114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88875
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-32462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07079
Species: Hu
NBP2-47278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADCK4 Antibody (NBP1-85509) (0)

There are no publications for ADCK4 Antibody (NBP1-85509).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADCK4 Antibody (NBP1-85509) (0)

There are no reviews for ADCK4 Antibody (NBP1-85509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADCK4 Antibody (NBP1-85509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADCK4 Products

Bioinformatics Tool for ADCK4 Antibody (NBP1-85509)

Discover related pathways, diseases and genes to ADCK4 Antibody (NBP1-85509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ADCK4 Antibody (NBP1-85509)

Find related products by research area.

Blogs on ADCK4

There are no specific blogs for ADCK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADCK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCK4