IDH3B Antibody - BSA Free

Western Blot: IDH3B Antibody [NBP2-14114] - Analysis using Anti-IDH3B antibody NBP2-14114 (A) shows similar pattern to independent antibody NBP2-58706 (B).

Immunocytochemistry/Immunofluorescence: IDH3B Antibody [NBP2-14114] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IDH3B Antibody [NBP2-14114] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: IDH3B Antibody [NBP2-14114] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: IDH3B Antibody [NBP2-14114] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: IDH3B Antibody [NBP2-14114] - Staining of human parathyroid gland shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IDH3B Antibody [NBP2-14114] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IDH3B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500-1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IDH3B Protein (NBP2-14114PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IDH3B Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.41
• FLJ11043
• H-IDHB
• isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
• isocitrate dehydrogenase 3 (NAD+) beta
• isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
• Isocitric dehydrogenase subunit beta
• MGC903
• NAD(+)-specific ICDH subunit beta
• NAD+-specific ICDH
• NAD+-specific isocitrate dehydrogenase b subunit
• NAD+-specific isocitrate dehydrogenase beta
• RP46

Background

IDH3B codes for a protein that has three isoforms, with lengths of 385, 383, and 233 amino acids, and weights of 42, 42, and 26 kDa respectively, and is a protein that is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase, which localizes to the mitochondrial matrix. Current studies are being done on several diseases and disorders related to this gene, including retinitis pigmentosa, blindness, and ataxia. IDH3B has also been shown to have interactions with MAPK6, MYC, IDH3G, PHLDA3, and IDH3A in pathways such as the TCA cycle and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IDH3B Antibody (NBP2-14114)(1)

Publication using NBP2-14114

• Ruan L, McNamara JT, Zhang X et al. Solid-phase inclusion as a mechanism for regulating unfolded proteins in the mitochondrial matrix Sci Adv 2020-08-01 [PMID: 32821848]

Bioinformatics

• Gene Symbol: IDH3B