FKBP10 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Analysis in human endometrium and skeletal muscle tissues using NBP2-49242 antibody. Corresponding FKBP10 RNA-seq data are ...read more
Western Blot: FKBP10 Antibody [NBP2-49242] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human placenta shows moderate to strong cytoplasmic positivity in fibroblasts.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human uterine cervix shows strong cytoplasmic positivity in fibroblasts.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FKBP10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FKBP10 Recombinant Protein Antigen (NBP2-49242PEP)

Reactivity Notes

Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP10 Antibody

  • 65 kDa FK506-binding protein
  • 65 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 10 (65 kDa)
  • FK506 binding protein 10, 65 kDa
  • FK506-binding protein 10
  • FKBP-10
  • FKBP6
  • FKBP-65
  • FKBP65PPIase FKBP10
  • FLJ20683
  • FLJ22041
  • FLJ23833
  • hFKBP65
  • Immunophilin FKBP65
  • OI6
  • peptidyl-prolyl cis-trans isomerase FKBP10
  • PPIASE
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-85364
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-38604
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97946
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85360
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85358
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FKBP10 Antibody (NBP2-49242) (0)

There are no publications for FKBP10 Antibody (NBP2-49242).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP10 Antibody (NBP2-49242) (0)

There are no reviews for FKBP10 Antibody (NBP2-49242). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP10 Antibody (NBP2-49242) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP10 Products

Bioinformatics Tool for FKBP10 Antibody (NBP2-49242)

Discover related pathways, diseases and genes to FKBP10 Antibody (NBP2-49242). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP10 Antibody (NBP2-49242)

Discover more about diseases related to FKBP10 Antibody (NBP2-49242).
 

Pathways for FKBP10 Antibody (NBP2-49242)

View related products by pathway.

PTMs for FKBP10 Antibody (NBP2-49242)

Learn more about PTMs related to FKBP10 Antibody (NBP2-49242).

Blogs on FKBP10

There are no specific blogs for FKBP10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP10