EPRS Antibody

Images

 
Independent Antibodies: Western Blot: EPRS Antibody [NBP1-84929] - Analysis using Anti-EPRS antibody NBP1-84929 (A) shows similar pattern to independent antibody NBP1-84930 (B).
Immunocytochemistry/ Immunofluorescence: EPRS Antibody [NBP1-84929] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human endometrium shows moderate cytoplasmic postivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

EPRS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPRS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EPRS Protein (NBP1-84929PEP)
Publications
Read Publications using
NBP1-84929 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse (88%), Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPRS Antibody

  • bifunctional aminoacyl-tRNA synthetase
  • Cell proliferation-inducing gene 32 protein
  • DKFZp313B047
  • EARS
  • EC 6.1.1
  • EC 6.1.1.15
  • EC 6.1.1.18
  • GLNS
  • GLUPRORS
  • glutamate tRNA ligase
  • glutaminyl-tRNA synthetase
  • glutamyl-prolyl-tRNA synthetase
  • PARSproliferation-inducing gene 32 protein
  • proliferation-inducing protein 32
  • proline tRNA ligase
  • proline-tRNA ligase
  • prolyl-tRNA synthetase
  • QARS
  • QPRS

Background

Glutamyl Prolyl tRNA synthetase (EPRS) is a component of ARS multi complex. EPRS is released and phosphorylated by IFN stimulation and forms a complex with GAIT.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-06563
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-47337
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19702
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86624
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
796-IC
Species: Mu
Applications: BA
NBP1-85937
Species: Hu, Mu
Applications: IHC, IHC-P, KD, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-20744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-13640
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84929
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for EPRS Antibody (NBP1-84929)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for EPRS Antibody (NBP1-84929) (0)

There are no reviews for EPRS Antibody (NBP1-84929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPRS Antibody (NBP1-84929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPRS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPRS