EPRS Antibody - BSA Free

Western Blot: EPRS Antibody [NBP1-84929] - Analysis using Anti-EPRS antibody NBP1-84929 (A) shows similar pattern to independent antibody NBP1-84930 (B).

Immunocytochemistry/Immunofluorescence: EPRS Antibody [NBP1-84929] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: EPRS Antibody [NBP1-84929] - Staining of human endometrium shows moderate cytoplasmic postivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EPRS Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPRS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EPRS Protein (NBP1-84929PEP)

Reactivity Notes

Mouse (88%), Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPRS Antibody - BSA Free

• bifunctional aminoacyl-tRNA synthetase
• Cell proliferation-inducing gene 32 protein
• DKFZp313B047
• EARS
• EC 6.1.1
• EC 6.1.1.15
• EC 6.1.1.18
• GLNS
• GLUPRORS
• glutamate tRNA ligase
• glutaminyl-tRNA synthetase
• glutamyl-prolyl-tRNA synthetase
• PARSproliferation-inducing gene 32 protein
• proliferation-inducing protein 32
• proline tRNA ligase
• proline-tRNA ligase
• prolyl-tRNA synthetase
• QARS
• QPRS

Background

Glutamyl Prolyl tRNA synthetase (EPRS) is a component of ARS multi complex. EPRS is released and phosphorylated by IFN stimulation and forms a complex with GAIT.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPRS Antibody (NBP1-84929)(2)

Publications using NBP1-84929

• Jin D, Zhu Y, Schubert HL et al. HIV-1 Gag Binds the Multi-Aminoacyl-tRNA Synthetase Complex via the EPRS Subunit Viruses 2023-02-08 [PMID: 36851687] (WB, Human)
• Jin D, Wek SA, Kudlapur NT et al. Disease-associated mutations in a bifunctional aminoacyl-tRNA synthetase gene elicit the integrated stress�response Journal of Biological Chemistry 2021-10-01 [PMID: 34537243]

Bioinformatics

• Gene Symbol: EPRS1