DHX38 Antibody

Images

 
Western Blot: DHX38 Antibody [NBP1-85269] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: DHX38 Antibody [NBP1-85269] - Staining of human cell line U-2 OS shows positivity in nucleus.
Immunohistochemistry-Paraffin: DHX38 Antibody [NBP1-85269] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Western Blot: DHX38 Antibody [NBP1-85269] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DHX38 Protein (NBP1-85269PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX38 Antibody

  • ATP-dependent RNA helicase DHX38
  • DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38
  • DEAH (Asp-Glu-Ala-His) box polypeptide 38
  • DEAH box protein 38
  • EC 3.6.1
  • EC 3.6.4.13
  • KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16
  • PRP16 homolog of S.cerevisiae
  • PRP16hPrp16
  • PRPF16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-586
Species: Hu
Applications: WB, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-81801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-92138
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for DHX38 Antibody (NBP1-85269) (0)

There are no publications for DHX38 Antibody (NBP1-85269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX38 Antibody (NBP1-85269) (0)

There are no reviews for DHX38 Antibody (NBP1-85269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHX38 Antibody (NBP1-85269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX38 Products

Bioinformatics Tool for DHX38 Antibody (NBP1-85269)

Discover related pathways, diseases and genes to DHX38 Antibody (NBP1-85269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX38 Antibody (NBP1-85269)

Discover more about diseases related to DHX38 Antibody (NBP1-85269).
 

Pathways for DHX38 Antibody (NBP1-85269)

View related products by pathway.

PTMs for DHX38 Antibody (NBP1-85269)

Learn more about PTMs related to DHX38 Antibody (NBP1-85269).

Blogs on DHX38

There are no specific blogs for DHX38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX38