ADAMTS13 Antibody

Images

 
Immunohistochemistry-Paraffin: ADAMTS13 Antibody [NBP2-14266] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNIT ANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAMTS13 Protein (NBP2-14266PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTS13 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 13
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 13
  • ADAM metallopeptidase with thrombospondin type 1 motif, 13
  • ADAMTS13
  • ADAM-TS13
  • ADAMTS-13
  • DKFZp434C2322
  • EC 3.4.24.14
  • EC 3.4.24.82
  • EC 3.4.24.87
  • FLJ42993
  • MGC118899
  • MGC118900
  • TTP
  • TTPADAM-TS 13
  • vWF-cleaving protease
  • vWF-CP
  • vWF-CPC9orf8
  • VWFCPvon Willebrand factor-cleaving protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14266
Species: Hu
Applications: IHC, IHC-P

Publications for ADAMTS13 Antibody (NBP2-14266) (0)

There are no publications for ADAMTS13 Antibody (NBP2-14266).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS13 Antibody (NBP2-14266) (0)

There are no reviews for ADAMTS13 Antibody (NBP2-14266). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAMTS13 Antibody (NBP2-14266) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMTS13 Products

Bioinformatics Tool for ADAMTS13 Antibody (NBP2-14266)

Discover related pathways, diseases and genes to ADAMTS13 Antibody (NBP2-14266). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS13 Antibody (NBP2-14266)

Discover more about diseases related to ADAMTS13 Antibody (NBP2-14266).
 

Pathways for ADAMTS13 Antibody (NBP2-14266)

View related products by pathway.

PTMs for ADAMTS13 Antibody (NBP2-14266)

Learn more about PTMs related to ADAMTS13 Antibody (NBP2-14266).
 

Research Areas for ADAMTS13 Antibody (NBP2-14266)

Find related products by research area.

Blogs on ADAMTS13

There are no specific blogs for ADAMTS13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS13
Entrez