ADAM11 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR |
| Predicted Species |
Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAM11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ADAM11 Antibody - BSA Free
Background
ADAM11, or Disintegrin and metalloproteinase domain-containing protein 11, contains a long 83 kDa isoform and a short 58 kDa isoform, and is involved in an assortment of biological processes consisting of cell-cell or cell-matrix interactions. Disease research is currently being studied with ADAM11 and its relation to breast, pancreatic, and prostate cancer, as well as pancreatitis, prostatitis, neuronitis, and alcoholism. This protein has been linked to the integrin-mediated signaling pathway where it interacts with STC2 and YWHAB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for ADAM11 Antibody (NBP2-62689) (0)
There are no publications for ADAM11 Antibody (NBP2-62689).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM11 Antibody (NBP2-62689) (0)
There are no reviews for ADAM11 Antibody (NBP2-62689).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ADAM11 Antibody (NBP2-62689) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAM11 Products
Research Areas for ADAM11 Antibody (NBP2-62689)
Find related products by research area.
|
Blogs on ADAM11