Novus Biologicals products are now on bio-techne.com

ADAM11 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ADAM11 Antibody [NBP2-62689] - Analysis in human cerebral cortex and pancreas tissues using Anti-ADAM11 antibody. Corresponding ADAM11 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: ADAM11 Antibody [NBP2-62689] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: ADAM11 Antibody [NBP2-62689] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ADAM11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAM11 Recombinant Protein Antigen (NBP2-62689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ADAM11 Antibody

  • a disintegrin and metalloproteinase domain 11
  • ADAM metallopeptidase domain 11
  • disintegrin and metalloproteinase domain-containing protein 11
  • MDCADAM 11
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein

Background

ADAM11, or Disintegrin and metalloproteinase domain-containing protein 11, contains a long 83 kDa isoform and a short 58 kDa isoform, and is involved in an assortment of biological processes consisting of cell-cell or cell-matrix interactions. Disease research is currently being studied with ADAM11 and its relation to breast, pancreatic, and prostate cancer, as well as pancreatitis, prostatitis, neuronitis, and alcoholism. This protein has been linked to the integrin-mediated signaling pathway where it interacts with STC2 and YWHAB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMD00
Species: Hu
Applications: ELISA
MCC170
Species: Mu
Applications: ELISA
MAB1567
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DIP100
Species: Hu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DRN00B
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
MME00
Species: Mu
Applications: ELISA
AF-492-NA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DY413
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for ADAM11 Antibody (NBP2-62689) (0)

There are no publications for ADAM11 Antibody (NBP2-62689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM11 Antibody (NBP2-62689) (0)

There are no reviews for ADAM11 Antibody (NBP2-62689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAM11 Antibody (NBP2-62689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM11 Products

Research Areas for ADAM11 Antibody (NBP2-62689)

Find related products by research area.

Blogs on ADAM11

There are no specific blogs for ADAM11, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM11