Reactivity | HuSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clone | CL0275 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
Epitope | MDPFDDDLKQ |
Specificity | Specificity of human ACSL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG1 |
Clonality | Monoclonal |
Host | Mouse |
Gene | ACSL5 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for ACSL5 Antibody (NBP2-52899)Discover more about diseases related to ACSL5 Antibody (NBP2-52899).
| Pathways for ACSL5 Antibody (NBP2-52899)View related products by pathway.
|
PTMs for ACSL5 Antibody (NBP2-52899)Learn more about PTMs related to ACSL5 Antibody (NBP2-52899).
| Research Areas for ACSL5 Antibody (NBP2-52899)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ACSL5 |