ACSL5 Antibody (CL0275)

Images

 
Western Blot: ACSL5 Antibody (CL0275) [NBP2-52899] - Lane 1: Marker [kDa], Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: ACSL5 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK ...read more
Immunohistochemistry-Paraffin: ACSL5 Antibody (CL0275) [NBP2-52899] - Staining of human small intestine shows very strong cytoplasmic and membrane immunoreactivity in the glandular cells.
Immunohistochemistry-Paraffin: ACSL5 Antibody (CL0275) [NBP2-52899] - Staining of human colon (colorectal cancer) shows moderate membrane positivity in cancer cells.
Immunohistochemistry-Paraffin: ACSL5 Antibody (CL0275) [NBP2-52899] - Staining of human colon shows strong positivity in the intestinal glands.
Immunohistochemistry: ACSL5 Antibody (CL0275) [NBP2-52899] - Staining of human duodenum shows strong cytoplasmic and membrane immunoreactivity in the glandular cells.
Immunohistochemistry-Paraffin: ACSL5 Antibody (CL0275) [NBP2-52899] - Staining of human liver shows moderate cytoplasmic immunoreactivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL0275
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACSL5 Antibody (CL0275) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK
Epitope
MDPFDDDLKQ
Specificity
Specificity of human ACSL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ACSL5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACSL5 Recombinant Protein Antigen (NBP2-52899PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ACSL5 Antibody (CL0275)

  • ACS2
  • ACS5FACL5 for fatty acid coenzyme A ligase 5
  • acyl-CoA synthetase long-chain family member 5
  • EC 6.2.1
  • EC 6.2.1.3
  • FACL5fatty acid coenzyme A ligase 5
  • fatty-acid-Coenzyme A ligase, long-chain 5
  • LACS 5
  • Long-chain acyl-CoA synthetase 5
  • long-chain fatty acid coenzyme A ligase 5
  • long-chain-fatty-acid--CoA ligase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90276
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89270
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92088
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15252
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-15253
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90265
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr

Publications for ACSL5 Antibody (NBP2-52899) (0)

There are no publications for ACSL5 Antibody (NBP2-52899).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL5 Antibody (NBP2-52899) (0)

There are no reviews for ACSL5 Antibody (NBP2-52899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL5 Antibody (NBP2-52899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACSL5 Products

Bioinformatics Tool for ACSL5 Antibody (NBP2-52899)

Discover related pathways, diseases and genes to ACSL5 Antibody (NBP2-52899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL5 Antibody (NBP2-52899)

Discover more about diseases related to ACSL5 Antibody (NBP2-52899).
 

Pathways for ACSL5 Antibody (NBP2-52899)

View related products by pathway.

PTMs for ACSL5 Antibody (NBP2-52899)

Learn more about PTMs related to ACSL5 Antibody (NBP2-52899).
 

Research Areas for ACSL5 Antibody (NBP2-52899)

Find related products by research area.

Blogs on ACSL5

There are no specific blogs for ACSL5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSL5 Antibody (CL0275) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL5