ACSL3 Antibody - BSA Free

Western Blot: ACSL3 Antibody [NBP1-89268] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-ACSL3 antibody. Corresponding ACSL3 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.

Western Blot: ACSL3 Antibody [NBP1-89268] - Analysis in control (vector only transfected HEK293T lysate) and ACSL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACSL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACSL3 Antibody - BSA Free (NBP1-89268) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACSL3 Protein (NBP1-89268PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACSL3 Antibody - BSA Free

• ACS3EC 6.2.1.3
• acyl-CoA synthetase long-chain family member 3
• FACL3lignoceroyl-CoA synthase
• fatty-acid-Coenzyme A ligase, long-chain 3
• LACS 3
• LACS3
• Long-chain acyl-CoA synthetase 3
• long-chain-fatty-acid--CoA ligase 3
• PRO2194

Background

Long-chain-fatty-acid--CoA ligase 3, or ACSL3, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both the biosynthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS3 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL3 mediates hepatic lipogenesis By similarity and has a mainly anabolic role in energy metabolism.

This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for ACSL3 Antibody (NBP1-89268) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 11/01/2019

Summary

• Application: Western Blot
• Sample Tested: Adult intestine
• Species: Mouse
• Lot: c115829

Comments

• Comments: Mouse small intestine was homogenised and protein content was quantified by a BCA assay. Twenty micrograms of protein were resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membranes. Membranes were probed with primary antibody ACSL3 diluted 1:1000 in 5% BSA 2, before incubation with Anti-rabbit secondary horseradish peroxidase-conjugated antibody 1:5000. Blots were visualised with Immobilon Western Chemiluminescence HRP Substrate and imaged with Syngene chemiluminescence imaging system.

Bioinformatics

• Gene Symbol: ACSL3