ACSL3 Antibody

Images

 
Orthogonal Strategies: Western Blot: ACSL3 Antibody [NBP1-89268] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-ACSL3 antibody. Corresponding ACSL3 RNA-seq data are presented for the same cell ...read more
Western Blot: ACSL3 Antibody [NBP1-89268] - Analysis in control (vector only transfected HEK293T lysate) and ACSL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP1-89268] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACSL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACSL3 Protein (NBP1-89268PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-89268 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSL3 Antibody

  • ACS3EC 6.2.1.3
  • acyl-CoA synthetase long-chain family member 3
  • FACL3lignoceroyl-CoA synthase
  • fatty-acid-Coenzyme A ligase, long-chain 3
  • LACS 3
  • LACS3
  • Long-chain acyl-CoA synthetase 3
  • long-chain-fatty-acid--CoA ligase 3
  • PRO2194

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-99585
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59645
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-92089
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15253
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
8475-OM/CF
Species: Hu
Applications: BA
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92065
Species: Hu
Applications: IHC, IHC-P
NBP2-37738
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ACSL3 Antibody (NBP1-89268) (0)

There are no publications for ACSL3 Antibody (NBP1-89268).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ACSL3 Antibody (NBP1-89268) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-89268:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ACSL3 NBP1-89268
Enlarge
4
reviewed by:
Verified Customer
WB Mouse 11/01/2019
View

Summary

ApplicationWestern Blot
Sample TestedAdult intestine
SpeciesMouse
Lotc115829

Comments

CommentsMouse small intestine was homogenised and protein content was quantified by a BCA assay. Twenty micrograms of protein were resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membranes. Membranes were probed with primary antibody ACSL3 diluted 1:1000 in 5% BSA 2, before incubation with Anti-rabbit secondary horseradish peroxidase-conjugated antibody 1:5000. Blots were visualised with Immobilon Western Chemiluminescence HRP Substrate and imaged with Syngene chemiluminescence imaging system.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL3 Antibody (NBP1-89268) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACSL3 Products

Bioinformatics Tool for ACSL3 Antibody (NBP1-89268)

Discover related pathways, diseases and genes to ACSL3 Antibody (NBP1-89268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL3 Antibody (NBP1-89268)

Discover more about diseases related to ACSL3 Antibody (NBP1-89268).
 

Pathways for ACSL3 Antibody (NBP1-89268)

View related products by pathway.

PTMs for ACSL3 Antibody (NBP1-89268)

Learn more about PTMs related to ACSL3 Antibody (NBP1-89268).
 

Research Areas for ACSL3 Antibody (NBP1-89268)

Find related products by research area.

Blogs on ACSL3

There are no specific blogs for ACSL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
11/01/2019
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol ACSL3