ACSBG1 Antibody

Images

 
Independent Antibodies: Western Blot: ACSBG1 Antibody [NBP2-58214] - Analysis using Anti-ACSBG1 antibody NBP2-58214 (A) shows similar pattern to independent antibody NBP2-31990 (B).
Immunocytochemistry/ Immunofluorescence: ACSBG1 Antibody [NBP2-58214] - Staining of human cell line SK-MEL-30 shows localization to nucleus & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

ACSBG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLKCTLDPDTSDQTDNLTEQAVEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILER
Specificity
Specificity of human ACSBG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSBG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACSBG1 Recombinant Protein Antigen (NBP2-58214PEP)

Reactivity Notes

Mouse 82%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ACSBG1 Antibody

  • acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3
  • BG1
  • BGMBG
  • bubblegum
  • FLJ30320
  • hBG1
  • hsBG
  • hsBGM
  • KIAA0631GR-LACS
  • lipidosin
  • long-chain-fatty-acid--CoA ligase ACSBG1
  • LPD
  • MGC14352
  • very long-chain acyl-CoA synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31593
Species: Hu
Applications: WB
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75633
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58214
Species: Hu
Applications: WB, ICC/IF

Publications for ACSBG1 Antibody (NBP2-58214) (0)

There are no publications for ACSBG1 Antibody (NBP2-58214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSBG1 Antibody (NBP2-58214) (0)

There are no reviews for ACSBG1 Antibody (NBP2-58214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACSBG1 Antibody (NBP2-58214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACSBG1 Products

Bioinformatics Tool for ACSBG1 Antibody (NBP2-58214)

Discover related pathways, diseases and genes to ACSBG1 Antibody (NBP2-58214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSBG1 Antibody (NBP2-58214)

Discover more about diseases related to ACSBG1 Antibody (NBP2-58214).

Research Areas for ACSBG1 Antibody (NBP2-58214)

Find related products by research area.

Blogs on ACSBG1

There are no specific blogs for ACSBG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSBG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSBG1