ACOX3 Antibody

Images

 
Western Blot: ACOX3 Antibody [NBP1-85901] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ACOX3 Antibody [NBP1-85901] - Staining of human cell line A-431 shows localization to peroxisomes.
Immunohistochemistry-Paraffin: ACOX3 Antibody [NBP1-85901] - Staining of human placenta shows moderate cytoplasmic and nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACOX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACOX3 Protein (NBP1-85901PEP)
Publications
Read Publication using
NBP1-85901 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25096407).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACOX3 Antibody

  • acyl-CoA oxidase 3, pristanoyl
  • Branched-chain acyl-CoA oxidase
  • BRCACox
  • BRCOX
  • EC 1.3.3.6
  • peroxisomal acyl-coenzyme A oxidase 3
  • PRCOX
  • pristanoyl
  • Pristanoyl-CoA oxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88364
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32599
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-60019
Species: Mu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-85901
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACOX3 Antibody (NBP1-85901)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ACOX3 Antibody (NBP1-85901) (0)

There are no reviews for ACOX3 Antibody (NBP1-85901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACOX3 Antibody (NBP1-85901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOX3 Products

ACOX3 NBP1-85901

Bioinformatics Tool for ACOX3 Antibody (NBP1-85901)

Discover related pathways, diseases and genes to ACOX3 Antibody (NBP1-85901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX3 Antibody (NBP1-85901)

Discover more about diseases related to ACOX3 Antibody (NBP1-85901).
 

Pathways for ACOX3 Antibody (NBP1-85901)

View related products by pathway.

PTMs for ACOX3 Antibody (NBP1-85901)

Learn more about PTMs related to ACOX3 Antibody (NBP1-85901).

Blogs on ACOX3

There are no specific blogs for ACOX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOX3