Aconitase 1 Antibody (2C1)

Images

 
Immunoprecipitation: Aconitase 1 Antibody (2C1) [H00000048-M01] - Analysis of ACO1 transfected lysate using anti-ACO1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACO1 MaxPab rabbit polyclonal ...read more
ELISA: Aconitase 1 Antibody (2C1) [H00000048-M01] - Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
2C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aconitase 1 Antibody (2C1) Summary

Immunogen
ACO1 (AAH18103, 780 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Localization
Cytoplasmic
Specificity
ACO1 - aconitase 1, soluble
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000048-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aconitase 1 Antibody (2C1)

  • aconitase 1, soluble
  • Aconitase
  • aconitate hydratase
  • Citrate hydro-lyase
  • cytoplasmic aconitate hydratase
  • EC 4.2.1
  • EC 4.2.1.3
  • Ferritin repressor protein
  • IREB1IREBP1
  • IRE-BP 1
  • IREBP
  • Iron regulatory protein 1
  • iron-responsive element binding protein 1
  • Iron-responsive element-binding protein 1
  • IRP1ACONS

Background

Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
AF3464
Species: Hu
Applications: WB, IHC
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, Gp, Ha, Pm, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004891-M01
Species: Hu, Mu, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aconitase 1 Antibody (H00000048-M01)(1)

Reviews for Aconitase 1 Antibody (H00000048-M01) (0)

There are no reviews for Aconitase 1 Antibody (H00000048-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aconitase 1 Antibody (H00000048-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Aconitase 1 Products

Bioinformatics Tool for Aconitase 1 Antibody (H00000048-M01)

Discover related pathways, diseases and genes to Aconitase 1 Antibody (H00000048-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 1 Antibody (H00000048-M01)

Discover more about diseases related to Aconitase 1 Antibody (H00000048-M01).
 

Pathways for Aconitase 1 Antibody (H00000048-M01)

View related products by pathway.

PTMs for Aconitase 1 Antibody (H00000048-M01)

Learn more about PTMs related to Aconitase 1 Antibody (H00000048-M01).

Blogs on Aconitase 1

There are no specific blogs for Aconitase 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aconitase 1 Antibody (2C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACO1
Entrez
OMIM
Uniprot