ACE-2 Recombinant Protein Antigen

Images

 
There are currently no images for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACE-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACE2.

Source: E. coli

Amino Acid Sequence: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACE2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88123.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACE-2 Recombinant Protein Antigen

  • ACE2
  • ACE-2
  • ACEH
  • ACEHangiotensin I converting enzyme 2
  • ACE-related carboxypeptidase
  • angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
  • angiotensin-converting enzyme 2
  • Angiotensin-converting enzyme homolog
  • DKFZp434A014
  • EC 3.4.17
  • EC 3.4.17.23
  • Metalloprotease MPROT15

Background

Angiotensin I Converting Enzyme 2 (ACE2), also known as ACEH (ACE homologue), is an integral membrane protein and a zinc metalloprotease of the ACE family (theoretical molecular weight 92 kDa). The predicted mouse ACE2 protein sequence consists of 798 amino acids, including an N-terminal signal peptide, a single catalytic domain, a C-terminal membrane anchor, and a short cytoplasmic tail. Mouse ACE2 is 40% homologous in amino acid identity to the N- and C-terminal domains of mouse somatic ACE. Enzymatically, ACE2 converts the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts Ang I to Ang II.

Genetic data from Drosophila, mice and rats show that the ACE2 protein is an essential regulator of heart function in vivo. ACE2 mRNA is found at high levels in testis, kidney and heart with moderate levels in colon, small intestine, and ovary. The ACE2 protein contributes to organ function through the renin-angiotensin system, playing a central role in vascular, renal, and myocardial physiology.

Virology research has demonstrated that the severe acute respiratory syndrome coronavirus (SARS-CoV) spike protein binds to its functional receptor, ACE2 (1). Vimentin is a type III intermediate filament protein expressed in mesenchymal cells that helps comprise the cytoskeleton in all animal cells. Studies have demonstrated that vimentin allows cell binding that allows the uptake of SARS-CoV spike protein into a host (2). This direct interaction of SARS-CoV with vimentin has been identified as an entry mechanism for the virus into a host, mediated by the SARS-CoV receptor ACE2 (1,2). It has been shown that ACE2 is the SARS-CoV-2 receptor required for cell entry and plays a physiological role in the replication of SARS-CoV in an infected host (1). Studies using human ACE2 antibody demonstrated a blockade of SARS-CoV-2 and ACE2 interaction, indicating an important physiological component of viral transmission and potential anti-viral therapeutic strategies (3).

References

1. Li, W., Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A., . . . Farzan, M. (2003). Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature, 426(6965), 450-454. doi:10.1038/nature02145

2. Yu YT, Chien SC, Chen IY, Lai CT, Tsay YG, Chang SC, Chang MF. (2016) Surface vimentin is critical for the cell entry of SARS-CoV. J Biomed Sci. doi: 10.1186/s12929-016-0234-7

3. Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kruger, N., Herrler, T., Erichsen, S., . . . Pohlmann, S. (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell. doi:10.1016/j.cell.2020.02.052

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DAN00
Species: Hu
Applications: ELISA
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
H00009197-M07
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DCP00
Species: Hu
Applications: ELISA
AF4965
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA

Publications for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP) (0)

There are no publications for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP) (0)

There are no reviews for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACE-2 Products

Research Areas for ACE-2 Recombinant Protein Antigen (NBP1-88123PEP)

Find related products by research area.

Blogs on ACE-2.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.

COVID-19 and the Cardiovascular System: Observed complications and potential mechanisms
By Victoria OsinskiThe outbreak of COVID-19 resulting from the transmission of the novel severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) has resulted in many cases of illness typically manifesting in mi...  Read full blog post.


  Read full blog post.


  Read full blog post.

Tiny Antibodies (VHHs) from Llama Neutralize Respiratory Coronaviruses
By Jamshed Arslan, Pharm. D., PhD. VHH Single Domain Antibodies vs Conventional AntibodiesThe immune system protects living organisms against harmful substances. B cells ward off infections by producing antibodies t...  Read full blog post.

Blocking SARS-CoV-2 Cell Entry: A potential Strategy Against COVID-19 Pandemic
By Jamshed Arslan, Pharm. D., PhD. Coronaviruses are a family of enveloped RNA viruses. Some family members circulate in human populations, but others like severe acute respiratory syndrome coronavirus (SARS-CoV) ar...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACE-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACE2