ACAD11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ACAD11 Antibody [NBP2-14255] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: ACAD11 Antibody [NBP2-14255] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAD11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINSILPNWNF FLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAD11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACAD11 Protein (NBP2-14255PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAD11 Antibody

  • ACAD-11
  • acyl-CoA dehydrogenase family member 11
  • acyl-CoA dehydrogenase family, member 11
  • acyl-Coenzyme A dehydrogenase family, member 11
  • EC 1.3.99.-
  • FLJ12592
  • MGC150619

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49511
Species: Hu
Applications: WB, IHC
NBP1-82749
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83328
Species: Hu
Applications: WB, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for ACAD11 Antibody (NBP2-14255) (0)

There are no publications for ACAD11 Antibody (NBP2-14255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD11 Antibody (NBP2-14255) (0)

There are no reviews for ACAD11 Antibody (NBP2-14255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACAD11 Antibody (NBP2-14255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAD11 Products

Bioinformatics Tool for ACAD11 Antibody (NBP2-14255)

Discover related pathways, diseases and genes to ACAD11 Antibody (NBP2-14255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAD11 Antibody (NBP2-14255)

Discover more about diseases related to ACAD11 Antibody (NBP2-14255).
 

Pathways for ACAD11 Antibody (NBP2-14255)

View related products by pathway.

Blogs on ACAD11

There are no specific blogs for ACAD11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAD11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAD11
Entrez
Uniprot