ACAD11 Antibody - BSA Free

Immunohistochemistry-Paraffin: ACAD11 Antibody [NBP2-14255] - Staining in human kidney and pancreas tissues.. Corresponding ACAD11 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACAD11 Antibody [NBP2-14255] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ACAD11 Antibody [NBP2-14255] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: ACAD11 Antibody [NBP2-14255] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: ACAD11 Antibody [NBP2-14255] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACAD11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: FSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINSILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACAD11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACAD11 Protein (NBP2-14255PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACAD11 Antibody - BSA Free

• ACAD-11
• acyl-CoA dehydrogenase family member 11
• acyl-CoA dehydrogenase family, member 11
• acyl-Coenzyme A dehydrogenase family, member 11
• EC 1.3.99.-
• FLJ12592
• MGC150619

Background

ACAD11, also known as Acyl-CoA dehydrogenase family member 11, consists of a 87 kDa, 76 kDa, and 74 kDa isoform, and is involved in processes regarding saturated C22-CoA. Disease research is currently being conducted on ACAD11 and its relation to hepatitis b, meningioma, neuroblastoma, mycobacterium tuberculosis, and leukemia. This protein has been linked to the process of fatty acid beta-oxidation where it interacts with ESR2, TbkBP1, CDC42, and ELOF1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACAD11
• Entrez:
  • 84129(Human)
• Uniprot:
  • Q709F0(Human)