ACAD10 Antibody - BSA Free

Western Blot: ACAD10 Antibody [NBP2-49511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human lymph node shows strong granular cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human kidney shows moderate positivity in cytoplasm granular in cells in tubules.

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human placenta shows strong positivity in cytoplasm granular in trophoblastic cells.

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACAD10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACAD10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACAD10 Recombinant Protein Antigen (NBP2-49511PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACAD10 Antibody - BSA Free

• ACAD-10
• acyl-CoA dehydrogenase family member 10
• acyl-CoA dehydrogenase family, member 10
• acyl-Coenzyme A dehydrogenase family, member 10
• EC 1.3.99.-
• MGC5601

Background

ACAD10 encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACAD10 Antibody (NBP2-49511)(1)

Publication using NBP2-49511

• Shim SM, Choi HR, Kwon SC et al. The Cys-N-degron pathway modulates pexophagy through the N-terminal oxidation and arginylation of ACAD10 Autophagy 2022-10-02 [PMID: 36184612]

Bioinformatics

• Gene Symbol: ACAD10