DDX25 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining in human testis and endometrium tissues using anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues.

Western Blot: DDX25 Antibody [NBP1-83328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-153

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes.

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX25 Antibody - BSA Free (NBP1-83328) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX25
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DDX25 Protein (NBP1-83328PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DDX25 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 25
• DEAD box protein 25
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25
• EC 3.6.1
• EC 3.6.4.13
• Gonadotropin-regulated testicular RNA helicase
• GRTHATP-dependent RNA helicase DDX25

Background

DDX25, also known as ATP-dependent RNA helicase DDX25, consists of a 54.7 kDa and a 42 kDa isoform and is involved in regulation of translation and export of mRNA during development of spermatid. The protein has been utilized in current research of diseases and disorders such as pneumonia, malaria, male infertility, and azoospermia. The protein is found in RNA binding pathways in the testis, pituitary, and hypothalamus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX25