DDX25 Antibody

Images

 
Western Blot: DDX25 Antibody [NBP1-83328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-153
Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial and neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DDX25 Protein (NBP1-83328PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX25 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 25
  • DEAD box protein 25
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25
  • EC 3.6.1
  • EC 3.6.4.13
  • Gonadotropin-regulated testicular RNA helicase
  • GRTHATP-dependent RNA helicase DDX25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1670-SE
Species: Ec
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-07755
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-83328
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DDX25 Antibody (NBP1-83328) (0)

There are no publications for DDX25 Antibody (NBP1-83328).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX25 Antibody (NBP1-83328) (0)

There are no reviews for DDX25 Antibody (NBP1-83328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX25 Antibody (NBP1-83328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX25 Products

DDX25 NBP1-83328

Bioinformatics Tool for DDX25 Antibody (NBP1-83328)

Discover related pathways, diseases and genes to DDX25 Antibody (NBP1-83328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX25 Antibody (NBP1-83328)

Discover more about diseases related to DDX25 Antibody (NBP1-83328).
 

Pathways for DDX25 Antibody (NBP1-83328)

View related products by pathway.

PTMs for DDX25 Antibody (NBP1-83328)

Learn more about PTMs related to DDX25 Antibody (NBP1-83328).
 

Research Areas for DDX25 Antibody (NBP1-83328)

Find related products by research area.

Blogs on DDX25

There are no specific blogs for DDX25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX25