ABCG8 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCG8 Antibody [NBP1-83388] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCG8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCG8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ABCG8 Protein (NBP1-83388PEP)
Publications
Read Publication using NBP1-83388.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCG8 Antibody

  • ATP-binding cassette sub-family G member 8
  • ATP-binding cassette, sub-family G (WHITE), member 8 (sterolin 2)
  • ATP-binding cassette, sub-family G (WHITE), member 8
  • GBD4ATP-binding cassette, subfamily G, member 8
  • MGC142217
  • sterolin 2
  • sterolin-2
  • STSL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB400-128
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45981
Species: Hu
Applications: IHC
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83388
Species: Hu
Applications: IHC, IHC-P

Publications for ABCG8 Antibody (NBP1-83388)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ABCG8 Antibody (NBP1-83388) (0)

There are no reviews for ABCG8 Antibody (NBP1-83388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCG8 Antibody (NBP1-83388). (Showing 1 - 1 of 1 FAQ).

  1. I have two options for ABCG8 primary antibodies from Novus Biologicals which we can use for fluorescence microscopy. Both of them have not been used/ tested in caco-2 cells (human colon carcinoma cell line) which is our model but for the below: 1) Used for IHC-P in liver, tonsil tissues (species human) http://www.novusbio.com/ABCG8-Antibody_NBP1-83388.html 2) Used for IHC-P in mouse intestine (species - mouse) http://www.novusbio.com/ABCG8-Antibody-1B10A5_NBP1-71706SS.html Out of the above two which do you and your team think will be more applicable for our purpose.
    • I have spoken to our team and we would recommend using NBP1-83388 and applying for our Innovators Reward Program. Because you are doing ICC staining and we have only tested in tissue. Since it is confirmed to react with human and stain tissue it should probably be a better candidate than testing one which has worked in mouse samples, but not been shown to detect the human form of the protein.

Secondary Antibodies

 

Isotype Controls

Additional ABCG8 Products

Bioinformatics Tool for ABCG8 Antibody (NBP1-83388)

Discover related pathways, diseases and genes to ABCG8 Antibody (NBP1-83388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCG8 Antibody (NBP1-83388)

Discover more about diseases related to ABCG8 Antibody (NBP1-83388).
 

Pathways for ABCG8 Antibody (NBP1-83388)

View related products by pathway.

PTMs for ABCG8 Antibody (NBP1-83388)

Learn more about PTMs related to ABCG8 Antibody (NBP1-83388).
 

Research Areas for ABCG8 Antibody (NBP1-83388)

Find related products by research area.

Blogs on ABCG8.

Understanding Sitosterolemia: How ABCG5-ABCG8 Dimer Affects Blood Sterol Levels
The ATP binding cassette (ABC) transporter family is the largest and most diverse family of membrane transport proteins and, as the name suggests, uses the energy generated by ATP hydrolysis to transport substrates across membranes. Eukaryotic ABC tra...  Read full blog post.

ABCG2: A Tumor Protector
ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily. Among ABC transporters ABCG2 is particularly interesting for its potential role in protecting cancer stem cells and its complex oligomeric structure (1). The ABC transporters...  Read full blog post.

Exploring how ABCG8 Affects Heart Disease
The high prevalence of atherosclerosis in developed nations is not breaking news; it has been well established that heart disease is the leading cause of death in the United States, and it presents a major socioeconomic burden. Investigators across th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCG8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCG8
Entrez
Uniprot