ABCA4 Recombinant Protein Antigen

Images

 
There are currently no images for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCA4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA4

Source: E. coli

Amino Acid Sequence: IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17333.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA4 Recombinant Protein Antigen

  • ABC10
  • ABCRRMP
  • ARMD2DKFZp781N1972
  • ATP binding cassette transporter
  • ATP-binding cassette sub-family A member 4
  • ATP-binding cassette transporter, retinal-specific
  • ATP-binding cassette, sub-family A (ABC1), member 4
  • ATP-binding transporter, retina-specific
  • CORD3
  • EC 3.6.3
  • FFMFLJ17534
  • photoreceptor rim protein
  • retinal-specific ATP-binding cassette transporter
  • retina-specific ABC transporter
  • RIM ABC transporter
  • RIM protein
  • RmP
  • RP19
  • Stargardt disease protein
  • STGD
  • STGD1

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is a retina-specific ABC transporter with N-retinylidene-PE as a substrate. It is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Mutations in this gene are found in patients diagnosed with Stargardt disease, a form of juvenile-onset macular degeneration. Mutations in this gene are also associated with retinitis pigmentosa-19, cone-rod dystrophy type 3, early-onset severe retinal dystrophy, fundus flavimaculatus, and macular degeneration age-related 2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5945
Species: Hu, Mu, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-24689
Species: Hu, Mu
Applications: WB
291-G1
Species: Hu
Applications: BA
NB100-757
Species: Hu
Applications: ChIP, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
NBP3-17333PEP
Species: Hu
Applications: AC

Publications for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP) (0)

There are no publications for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP) (0)

There are no reviews for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCA4 Products

Research Areas for ABCA4 Recombinant Protein Antigen (NBP3-17333PEP)

Find related products by research area.

Blogs on ABCA4

There are no specific blogs for ABCA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA4