ABCA2 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCA2 Antibody [NBP2-14249] Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLL ERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTV SSFSLDSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCA2 Protein (NBP2-14249PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCA2 Antibody

  • ABC2ATP-binding cassette, sub-family A, member 2
  • ATP-binding cassette 2
  • ATP-binding cassette sub-family A member 2
  • ATP-binding cassette transporter 2
  • ATP-binding cassette, sub-family A (ABC1), member 2
  • EC 3.6.3
  • EC 3.6.3.41
  • KIAA1062
  • MGC129761

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-14249
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for ABCA2 Antibody (NBP2-14249) (0)

There are no publications for ABCA2 Antibody (NBP2-14249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA2 Antibody (NBP2-14249) (0)

There are no reviews for ABCA2 Antibody (NBP2-14249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCA2 Antibody (NBP2-14249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCA2 Products

Bioinformatics Tool for ABCA2 Antibody (NBP2-14249)

Discover related pathways, diseases and genes to ABCA2 Antibody (NBP2-14249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA2 Antibody (NBP2-14249)

Discover more about diseases related to ABCA2 Antibody (NBP2-14249).
 

Pathways for ABCA2 Antibody (NBP2-14249)

View related products by pathway.

PTMs for ABCA2 Antibody (NBP2-14249)

Learn more about PTMs related to ABCA2 Antibody (NBP2-14249).
 

Research Areas for ABCA2 Antibody (NBP2-14249)

Find related products by research area.

Blogs on ABCA2

There are no specific blogs for ABCA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA2
Entrez
Uniprot