ABCA8 Antibody

Immunohistochemistry-Paraffin: ABCA8 Antibody [NBP1-91641] - Staining in human ovary and pancreas tissues using anti-ABCA8 antibody. Corresponding ABCA8 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: ABCA8 Antibody [NBP1-91641] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ABCA8 Antibody [NBP1-91641] - Staining of human ovary shows high expression.

Immunohistochemistry-Paraffin: ABCA8 Antibody [NBP1-91641] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ABCA8 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCA8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ABCA8 Protein (NBP1-91641PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABCA8 Antibody

• ATP-binding cassette sub-family A member 8
• ATP-binding cassette, sub-family A (ABC1), member 8
• EC 3.6.3
• EC 3.6.3.41
• KIAA0822MGC163152

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. The function of this protein has not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCA8
• Entrez:
  • 10351(Human)
• Uniprot:
  • O94911(Human)