AADAC Antibody

Images

 
Western Blot: AADAC Antibody [NBP1-69445] - This Anti-AADAC antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 2.5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AADAC Antibody Summary

Immunogen
Synthetic peptides corresponding to AADAC(arylacetamide deacetylase (esterase)) The peptide sequence was selected from the C terminal of AADAC. Peptide sequence NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AADAC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AADAC and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AADAC Antibody

  • arylacetamide deacetylase (esterase)
  • arylacetamide deacetylase
  • CES5A1
  • DACEC 3.1.1.3
  • EC 3.1.1
  • EC 3.1.1.79

Background

Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14013
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
46780002
Species: Hu
Applications: ELISA
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
MAB5657
Species: Hu
Applications: WB, IP, ICC

Publications for AADAC Antibody (NBP1-69445) (0)

There are no publications for AADAC Antibody (NBP1-69445).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AADAC Antibody (NBP1-69445) (0)

There are no reviews for AADAC Antibody (NBP1-69445). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AADAC Antibody (NBP1-69445) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AADAC Products

Bioinformatics Tool for AADAC Antibody (NBP1-69445)

Discover related pathways, diseases and genes to AADAC Antibody (NBP1-69445). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AADAC Antibody (NBP1-69445)

Discover more about diseases related to AADAC Antibody (NBP1-69445).
 

Pathways for AADAC Antibody (NBP1-69445)

View related products by pathway.

PTMs for AADAC Antibody (NBP1-69445)

Learn more about PTMs related to AADAC Antibody (NBP1-69445).

Blogs on AADAC

There are no specific blogs for AADAC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AADAC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AADAC
Uniprot