![Immunocytochemistry/Immunofluorescence: A4GNT Antibody [NBP1-89129] - Staining of human cell line U-2 OS shows positivity in vesicles.](http://images.novusbio.com/fullsize2/A4GNT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89129-img0004.jpg "Immunocytochemistry/Immunofluorescence: A4GNT Antibody [NBP1-89129] - Staining of human cell line U-2 OS shows positivity in vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG |
| Specificity | Specificity of human A4GNT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | A4GNT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for A4GNT Antibody (NBP1-89129)Discover more about diseases related to A4GNT Antibody (NBP1-89129).
| Pathways for A4GNT Antibody (NBP1-89129)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows high expression.](http://images.novusbio.com/fullsize2/A4GNT-Antibody-Immunohistochemistry-Paraffin-NBP1-89129-img0007.jpg "Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows high expression.")
![Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/A4GNT-Antibody-Immunohistochemistry-Paraffin-NBP1-89129-img0005.jpg "Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize2/A4GNT-Antibody-Immunohistochemistry-Paraffin-NBP1-89129-img0006.jpg "Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining in human stomach and pancreas tissues using anti-A4GNT antibody. Corresponding A4GNT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/A4GNT Antibody-Immunohistochemistry-Paraffin-NBP1-89129-img0008.jpg "Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining in human stomach and pancreas tissues using anti-A4GNT antibody. Corresponding A4GNT RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Gastric Mucin Antibody (CLH5) [NBP2-44374] - Human Gastric Carcinoma stained with MUC6 Monoclonal Antibody (CLH5).](http://images.novusbio.com/fullsize2/Gastric Mucin Antibody (CLH5)-Immunohistochemistry-Paraffin-NBP2-44374-img0001.jpg)
![Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Total protein from human HeLa and A431 cells, mouse 3T3 cells and rat PC12 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-GPR78 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/fullsize2/GRP78-HSPA5-Antibody-Western-Blot-NBP1-06274-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/GRP78-HSPA5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-06274-img0013.jpg)
![Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on HeLa with GRP78/HSPA5 Antibody NBP1-06274 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).](http://images.novusbio.com/fullsize2/GRP78-HSPA5-Antibody-Flow-Cytometry-NBP1-06274-img0012.jpg)
![Western Blot: Calnexin Antibody [NB100-1965] - A dilution of 1/2000 used in TBS with 0.05% Tween-20. Bands visualized by ECL using goat anti-rabbit HRP at 1:2000.](http://images.novusbio.com/fullsize2/Calnexin-Antibody-Western-Blot-NB100-1965-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Calnexin Antibody [NB100-1965] - Antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).](http://images.novusbio.com/fullsize2/Calnexin-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1965-img0009.jpg)
![Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/Calnexin-Antibody-Immunohistochemistry-NB100-1965-img0010.jpg)
![Immunohistochemistry-Paraffin: Mucin 5AC Antibody (45M1) [NBP2-15196] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC5AC Monoclonal Antibody (45M1).](http://images.novusbio.com/fullsize2/Mucin-5AC-Antibody-(45M1)-Immunohistochemistry-Paraffin-NBP2-15196-img0011.jpg)
![Flow Cytometry: Mucin 5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196PE (blue) and a matched isotype control NBP2-27287PE (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both Antibodies were conjugated to Phycoerythrin.](http://images.novusbio.com/fullsize2/Mucin-5AC-Antibody-(45M1)-Flow-Cytometry-NBP2-15196-img0010.jpg)
![Immunohistochemistry-Paraffin: Mucin 5AC Antibody (45M1) [NBP2-15196] - Analysis using the Azide and BSA Free version of NBP2-15196. Detection Human stomach.](http://images.novusbio.com/fullsize2/Mucin-5AC-Antibody-(45M1)-Immunohistochemistry-Paraffin-NBP2-15196-img0006.jpg)
![Western Blot: GAPDH Antibody (1D4) [NB300-221] - analysis of GAPDH in human nucleus pulposus cell culture (40ug/lane) using anti-GAPDH antibody. LI-COR Odyssey imaging system was used for detection. Image from verified customer review.](http://images.novusbio.com/fullsize2/GAPDH-Antibody-(1D4)-Western-Blot-NB300-221-img0005.jpg)
![Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH, NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.](http://images.novusbio.com/fullsize2/GAPDH-Antibody-(1D4)-Western-Blot-NB300-221-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green) and Neurofilament Heavy antibody NB300-217 (red), counterstained with a fluorescent DNA probe (blue).](http://images.novusbio.com/fullsize2/GAPDH-Antibody-(1D4)-Immunocytochemistry-Immunofluorescence-NB300-221-img0007.jpg)
![Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line](http://images.novusbio.com/fullsize2/SOS1-Antibody-(SOS-01)-Western-Blot-NB110-68800-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).](http://images.novusbio.com/fullsize2/SOS1-Antibody-(SOS-01)-Immunocytochemistry-Immunofluorescence-NB110-68800-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).](http://images.novusbio.com/fullsize2/SOS1-Antibody-(SOS-01)-Immunocytochemistry-Immunofluorescence-NB110-68800-img0004.jpg)
![Western Blot: GCNT3 Antibody [NBP1-88313] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize2/GCNT3-Antibody-Western-Blot-NBP1-88313-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: GCNT3 Antibody [NBP1-88313] - Immunofluorescent staining of human cell line A549 shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize2/GCNT3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88313-img0014.jpg)
![Immunohistochemistry-Paraffin: GCNT3 Antibody [NBP1-88313] - Staining in human rectum and liver tissues using anti-GCNT3 antibody. Corresponding GCNT3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/GCNT3-Antibody-Immunohistochemistry-Paraffin-NBP1-88313-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.](http://images.novusbio.com/fullsize2/MUC-1-Antibody-(SM3)-Immunocytochemistry-Immunofluorescence-NB120-22711-img0001.jpg)
![Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.](http://images.novusbio.com/fullsize2/MUC-1-Antibody-(SM3)-Immunohistochemistry-Paraffin-NB120-22711-img0003.jpg)
![Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong diffused immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.](http://images.novusbio.com/fullsize2/MUC-1-Antibody-(SM3)-Immunohistochemistry-Paraffin-NB120-22711-img0002.jpg)
![Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human brain](http://images.novusbio.com/fullsize2/G protein alpha inhibitor 1 Antibody-Western Blot-NBP1-52926-img0006.jpg)
![Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000](http://images.novusbio.com/fullsize2/G-protein-alpha-inhibitor-1-Antibody-Western-Blot-NBP1-52926-img0002.jpg)
![Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/G-protein-alpha-inhibitor-1-Antibody-Western-Blot-NBP1-52926-img0004.jpg)
![Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in human cell lines MCF-7 and A-431 using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.](http://images.novusbio.com/fullsize2/TFF1-pS2 Antibody-Western Blot-NBP1-90813-img0019.jpg)
![Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/TFF1-pS2-Antibody-Immunohistochemistry-Paraffin-NBP1-90813-img0017.jpg)
![Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize2/TFF1-pS2-Antibody-Immunohistochemistry-Paraffin-NBP1-90813-img0015.jpg)
![Western Blot: TFF3 Antibody [NBP1-76514] - Analysis of TFF3 in human colon tissue lysate with TFF3 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide](http://images.novusbio.com/fullsize2/TFF3-Antibody-Western-Blot-NBP1-76514-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: TFF3 Antibody [NBP1-76514] - TFF3 in human small intestine tissue with TFF3 antibody at 20 ug/ml.](http://images.novusbio.com/fullsize2/TFF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76514-img0006.jpg)
![Immunohistochemistry-Paraffin: TFF3 Antibody [NBP1-76514] - TFF3 in human small intestine tissue with TFF3 antibody at 2 ug/ml.](http://images.novusbio.com/fullsize2/TFF3-Antibody-Immunohistochemistry-Paraffin-NBP1-76514-img0007.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")