Home » A4GNT » A4GNT Antibodies » A4GNT Antibody

A4GNT Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining in human stomach and pancreas tissues using anti-A4GNT antibody. Corresponding A4GNT RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining in human stomach and pancreas tissues using anti-A4GNT antibody. Corresponding A4GNT RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows high expression.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

A4GNT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A4GNT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
A4GNT Protein (NBP1-89129PEP)
Publications
Read Publication using
NBP1-89129 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32025032).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for A4GNT Antibody

  • A4GNT
  • alpha-1,4-N-acetylglucosaminyltransferase
  • alpha4GnT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MUC6 Antibody
(CLH5)
NBP2-44374
Immunohistochemistry-Paraffin: MUC6 Antibody (CLH5) [NBP2-44374] - Human Gastric Carcinoma stained with MUC6 Monoclonal Antibody (CLH5).
Immunohistochemistry-Paraffin: MUC6 Antibody (CLH5) [NBP2-44374] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC6 Antibody (CLH5). Courtesy of Dr. Leonor David, IPATIMUP and Medical Faculty, University of Porto, Portugal
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P
GRP78/HSPA5
Antibody
NBP1-06274
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on Jurkat cells with Alexa Fluor 647 conjugate of GPR78/HSPA5 antibody NBP1-06274AF647 (blue) and a matched isotype control NBP2-24893AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on HeLa with NBP1-06274 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/mL overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(30 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Calnexin Antibody
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Citeab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - Calnexin immunostaining in the anterior (AI) and mid (MI) intestine of ctrl (control zebrafish), D.I.O. (diet-induced obesity zebrafish), D.I.O. flw 3,5-T2 (D.I.O. zebrafish followed by 3,5-T2), D.I.O. with 3,5-T2 (D.I.O. zebrafish treated with 3,5-T2). (A) AI of ctrl zebrafish (B) AI of D.I.O. (C) AI of D.I.O. flw 3,5-T2. (D) AI of D.I.O. with 3,5-T2. The arrows indicate calnexin immunoexpression in the enteroendocrine and goblet cells. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2076-2615/10/7/1131/htm#) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(1 Review)
(29 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
MUC5AC Antibody
(45M1)
NBP2-15196
Flow Cytometry: MUC5AC Antibody (45M1) [NBP2-15196] - Analysis using the Azide and BSA Free version of NBP2-15196. Staining of fixed (70% ethanol or 80% methanol) and permeabilized A549 cells
Immunohistochemistry-Paraffin: MUC5AC Antibody (45M1) [NBP2-15196] - Analysis using the Azide and BSA Free version of NBP2-15196. Detection Human stomach.
Flow (Intracellular): MUC5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196 (blue) and a matched isotype control NBP2-27287 (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
(5 Reviews)
(13 Publications)
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green). Nuclear DNA is stained with Hoechst dye (blue).
(19 Reviews)
(345 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
HGF [Unconjugated]
294-HG
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(5 Reviews)
(94 Publications)
Species: Hu
Applications: BA
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: ICC/IF, WB
GCNT3 Antibody
NBP1-88313
Immunocytochemistry/Immunofluorescence: GCNT3 Antibody [NBP1-88313] - Immunofluorescent staining of human cell line A549 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GCNT3 Antibody [NBP1-88313] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: GCNT3 Antibody [NBP1-88313] - Staining of human rectum shows high expression.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MUC1 Antibody
NBP1-60046
Knockout Validated: MUC1 Antibody [NBP1-60046] - C57BL/6 Muc1 KO mice and WT mice were undergoing intranasal instillation of 75 ug of lipopolysaccharide (LPS) at day 1. Between days 2 and 3, animals were exposed to cigarette smoke (or control air) of 6 cigarettes followed by 8 cigarettes (or control air) at days 4 and 5, and 10 cigarettes (or control air) at day 6. Vehicle or dexamethasone at 3 mg/kg/day and 10 mg/kg/day was administered orally once a day between day 1 and 6. Animals were sacrificed at day 6 and lungs were homogenized to analyze protein expression of Muc1 cytoplasmic tail (CT). Protein expression was normalized to B-actin. Image collected and cropped by CiteAb from the following publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-018-0927-4) licensed under a CC-BY licence.
Knockout Validated: MUC1 Antibody [NBP1-60046] - Dexamethasone induces Muc1-CT nuclear translocation and co-localization with GRa in bronchial epithelium of WT mice but not in MUC1 KO mice. C57BL/6 Muc1 KO mice and WT mice were undergoing dexamethasone 10 mg/kg/day (orally) for 6 days. Animals were sacrificed at day 6 and lungs were fixed in paraformaldehyde (4%) for 48 h and embedded. Lung slices were immunostained with MUC1-cytoplasmic tail (CT) (red) and glucocorticoid receptor alpha (GRa) antibodies (green) with rhodamine/fluorescein secondary antibodies. DAPI was used to mark cell nucleus. Representative con-focal images are showed. Scale bar: 5 um. Image collected and cropped by CiteAb from the following publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-018-0927-4) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: MUC1 Antibody [NBP1-60046] - Pig stomach.
(4 Publications)
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Human MUC20 ELISA
Kit (Colorimetric)
NBP2-76702
ELISA: Human MUC20 ELISA Kit (Colorimetric) [NBP2-76702] - Standard Curve Reference
Species: Hu
Applications: ELISA
G protein alpha
inhibitor 1 Antibody
NBP1-52926
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human brain
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000
(1 Publication)
Species: Hu
Applications: WB
CD43/Sialophorin
Antibody (W3/13)
NB100-64992
Immunohistochemistry-Paraffin: CD43/Sialophorin Antibody (W3/13) [NB100-64992] - CD43 was detected in immersion fixed paraffin-embedded sections of rat thymus using Mouse Anti-Rat CD43 Monoclonal Antibody (Catalog # NB100-64992) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was incubated with VisUBlock™ Mouse on Mouse Blocking Reagent (Catalog # VB001) and then subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Western Blot: CD43/Sialophorin Antibody (W3/13) [NB100-64992] - Western blot shows lysates of rat lymph node, rat spleen tissue, and rat thymus tissue. PVDF membrane was probed with 0.5 ug/mL of Mouse Anti-Rat CD43 Monoclonal Antibody (Catalog # NB100-64992) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for CD43 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions.
Flow Cytometry: CD43/Sialophorin Antibody (W3/13) [NB100-64992] - Staining of rat splenocytes using CD43 FITC.
(3 Publications)
Species: Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, WB
IL-6 [HRP]
D6050
(31 Reviews)
(548 Publications)
Species: Hu
Applications: ELISA
TFF1/pS2 Antibody
NBP1-90813
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CCL2/JE/MCP-1 [HRP]
DCP00
(7 Reviews)
(197 Publications)
Species: Hu
Applications: ELISA
TFF3 Antibody
NBP1-76514
Immunofluorescence: TFF3 Antibody [NBP1-76514] - in Human Small Intestine cells with TFF3 antibody at 20 ug/mL.
Immunocytochemistry: TFF3 Antibody [NBP1-76514] - TFF3 in HeLa cells with TFF3 antibody at 2 ug/ml.
Immunofluorescence: TFF3 Antibody [NBP1-76514] - TFF3 in human small intestine tissue with TFF3 antibody at 20 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
IL-11
[Unconjugated]
418-ML/CF
IL-11 [Unconjugated]
(26 Publications)
Species: Mu
Applications: BA

Publications for A4GNT Antibody (NBP1-89129)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for A4GNT Antibody (NBP1-89129) (0)

There are no reviews for A4GNT Antibody (NBP1-89129). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for A4GNT Antibody (NBP1-89129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional A4GNT Products

Bioinformatics Tool for A4GNT Antibody (NBP1-89129)

Discover related pathways, diseases and genes to A4GNT Antibody (NBP1-89129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A4GNT Antibody (NBP1-89129)

Discover more about diseases related to A4GNT Antibody (NBP1-89129).
 

Pathways for A4GNT Antibody (NBP1-89129)

View related products by pathway.

Blogs on A4GNT

There are no specific blogs for A4GNT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our A4GNT Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol A4GNT
Entrez
Uniprot