A4GNT Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining in human stomach and pancreas tissues using anti-A4GNT antibody. Corresponding A4GNT RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows high expression.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

A4GNT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A4GNT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
A4GNT Protein (NBP1-89129PEP)
Publications
Read Publication using
NBP1-89129 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32025032).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for A4GNT Antibody

  • A4GNT
  • alpha-1,4-N-acetylglucosaminyltransferase
  • alpha4GnT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
AF1543
Species: Hu
Applications: IHC, WB
294-HG
Species: Hu
Applications: BA
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-88313
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-60046
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
NBP2-76702
Species: Hu
Applications: ELISA
NBP1-52926
Species: Hu
Applications: WB
NB100-64992
Species: Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-76514
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
418-ML/CF
Species: Mu
Applications: BA

Publications for A4GNT Antibody (NBP1-89129)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for A4GNT Antibody (NBP1-89129) (0)

There are no reviews for A4GNT Antibody (NBP1-89129). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for A4GNT Antibody (NBP1-89129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional A4GNT Products

Bioinformatics Tool for A4GNT Antibody (NBP1-89129)

Discover related pathways, diseases and genes to A4GNT Antibody (NBP1-89129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A4GNT Antibody (NBP1-89129)

Discover more about diseases related to A4GNT Antibody (NBP1-89129).
 

Pathways for A4GNT Antibody (NBP1-89129)

View related products by pathway.

Blogs on A4GNT

There are no specific blogs for A4GNT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our A4GNT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol A4GNT
Entrez
Uniprot