A20/TNFAIP3 Recombinant Protein Antigen

Images

 
There are currently no images for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

A20/TNFAIP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human A20/TNFAIP3.

Source: E. coli

Amino Acid Sequence: AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFAIP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68857.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for A20/TNFAIP3 Recombinant Protein Antigen

  • A20
  • A20TNFA1P2
  • EC 3.4.19.12
  • EC 6.3.2.-
  • MGC104522
  • MGC138687
  • OTU domain-containing protein 7C
  • OTUD7C
  • OTUD7CMGC138688
  • Putative DNA-binding protein A20
  • TNF alpha-induced protein 3
  • TNFA1P2
  • TNFAIP3
  • tumor necrosis factor alpha-induced protein 3
  • tumor necrosis factor inducible protein A20
  • tumor necrosis factor, alpha-induced protein 3
  • Zinc finger protein A20

Background

A20, TNFalpha-induced protein 3, TNFAIP3 (theoretical molecular weight 95 kDa) is an important regulator of pro-inflammatory signaling pathways such as NF-kB activation and tumor necrosis factor (TNF)-mediated programmed cell death (1, 2). In macrophages, A20/TNFAIP3 controls the release of IL-1 beta/IL-18 by regulating NLRP3 inflammasome activity and CXCL9/CXCL10 production via STAT1 signaling. By regulating the expression of inflammatory molecules such as IL-6 and anti-apoptotic proteins in dendritic cells, A20/TNFAIP3 maintains T-cell and B-cell homeostasis.

A20/TNFAIP3 is a highly conserved protein sharing >90% amino acid sequence identity across various mammalian species and is highly expressed in T-cell and B-cells. Coding and non-coding single nucleotide polymorphisms (SNPs) of A20/TNFAIP3 have been associated with multiple autoinflammatory and autoimmune diseases including type 1 diabetes, rheumatoid arthritis, Crohn's disease, and systemic lupus erythematosus (SLE) (3). The two domains of A20/TNFAIP3 cooperate to regulate NF-kB signaling. Its N-terminal ovarian tumor (OTU) domain contains a catalytic cysteine (C103) which functions as a K63 deubiquitinase, whereas the 7 zinc fingers that make up the C-terminal domain mediate K48 polyubiquitination. To regulate NF-kB signaling, A20/TNFAIP3 removes K63-polyubiquitin chains from receptor-interacting protein 1 (RIP1) and NF-kB essential modulator (NEMO), thus preventing interactions with downstream partners. A20/TNFAIP3 also contributes to the degradation of RIP1 and Ubc13 through the addition of K48 polyubiquitin chains (4).

References

1.Dixit VM1, Green S, Sarma V, Holzman LB, Wolf FW, O'Rourke K, Ward PA, Prochownik EV, Marks RM. (1990) Tumor necrosis factor-alpha induction of novel gene products in human endothelial cells including a macrophage-specific chemotaxin. J Biol Chem. 265(5):2973-8. PMID: 2406243

2.Verstrepen L, Verhelst K, van Loo G, Carpentier I, Ley SC, Beyaert R. (2010) Expression, biological activities and mechanisms of action of A20 (TNFAIP3). Biochem Pharmacol. 80(12):2009-20. PMID: 20599425

3.Mele A, Cervantes JR, Chien V, Friedman D, Ferran C. (2014) Single nucleotide polymorphisms at the TNFAIP3/A20 locus and susceptibility/resistance to inflammatory and autoimmune diseases. Adv Exp Med Biol. 809:163-83. PMID: 25302371

4.Das T, Chen Z, Hendriks RW, Kool M. (2018) A20/Tumor Necrosis Factor alpha-Induced Protein 3 in Immune Cells Controls Development of Autoinflammation and Autoimmunity: Lessons from Mouse Models. Front Immunol. 9:104. PMID: 29515565

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
202-IL
Species: Hu
Applications: BA
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NB100-56170
Species: Bv, Ca, Hu
Applications: IHC,  IHC-P, IP, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
7398-FS
Species: Hu
Applications: BA
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
AF796
Species: Mu
Applications: AdBlk, IHC, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP) (0)

There are no publications for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP) (0)

There are no reviews for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP). (Showing 1 - 1 of 1 FAQ).

  1. Following cleavage of A20/TNFAIP3, two full length fragments are released, one with 37 kDa and other one was approx. at 52 kDa. There are mentioning of 75Kda fragment and 37 KDa fragment in scientific papers but not 52 KDa. What is the significance of that specific band?
    • There is data available that explains 52 KDa band in A20/TNFAIP3. Using this antibody in Western Blot will result multiple bands. In LPS treatment, 52 KDa putative cleavage band was observed; however, the same band was not found in untreated THP1 cells.

Additional A20/TNFAIP3 Products

Research Areas for A20/TNFAIP3 Recombinant Protein Antigen (NBP2-68857PEP)

Find related products by research area.

Blogs on A20/TNFAIP3

There are no specific blogs for A20/TNFAIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our A20/TNFAIP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP3