5-HT4 Antibody

Images

 
Immunohistochemistry: 5-HT4 Antibody [NBP2-14109] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQW ESQCHPPATSPLVAAQPSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
5-HT4 Protein (NBP2-14109PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT4 Antibody

  • 5HT4
  • 5-HT4
  • 5-HT-4
  • 5-HT4R
  • 5-hydroxytryptamine (serotonin) receptor 4,5-hydroxytryptamine receptor 4,5-HT45-hydroxytryptamine4 receptor
  • cardiac 5-HT4 receptor
  • HTR4
  • Serotonin receptor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
AF2180
Species: Hu
Applications: WB, Simple Western, IP
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-52926
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-14109
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for 5-HT4 Antibody (NBP2-14109) (0)

There are no publications for 5-HT4 Antibody (NBP2-14109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT4 Antibody (NBP2-14109) (0)

There are no reviews for 5-HT4 Antibody (NBP2-14109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5-HT4 Antibody (NBP2-14109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5-HT4 Products

Bioinformatics Tool for 5-HT4 Antibody (NBP2-14109)

Discover related pathways, diseases and genes to 5-HT4 Antibody (NBP2-14109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT4 Antibody (NBP2-14109)

Discover more about diseases related to 5-HT4 Antibody (NBP2-14109).
 

Pathways for 5-HT4 Antibody (NBP2-14109)

View related products by pathway.

PTMs for 5-HT4 Antibody (NBP2-14109)

Learn more about PTMs related to 5-HT4 Antibody (NBP2-14109).
 

Research Areas for 5-HT4 Antibody (NBP2-14109)

Find related products by research area.

Blogs on 5-HT4

There are no specific blogs for 5-HT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR4
Entrez