5-HT2B Antibody

Images

 
Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Immunocytochemistry/ Immunofluorescence: 5-HT2B Antibody [NBP1-55429] - Spinal Cord, ventral horns of mouse, 1.3ug/mL Image Submitted By: Timur Mavlyutov, PhD Department of Pharmacology University of Wisconsin Medical ...read more
Western Blot: 5-HT2B Antibody [NBP1-55429] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Bv, EqSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT2B Antibody Summary

Immunogen
Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (100%), Equine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This is a rabbit polyclonal antibody against HTR2B and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-55429 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for 5-HT2B Antibody

  • 5-HT(2B)
  • 5HT2B
  • 5-HT2B
  • 5-HT-2B
  • 5-HT2B5-HT 2B receptor
  • 5-hydroxytryptamine (serotonin) receptor 2B
  • 5-hydroxytryptamine 2B receptor
  • 5-hydroxytryptamine receptor 2B
  • HTR2B
  • Serotonin receptor 2B

Background

5-HT2B, a Serotonin Receptor, activates phospholipase C upon binding serotonin, which results in a rise in intracellular calcium. It is known that 5-HT2B regulates cardiovascular function during development and in adulthood; mice lacking functional 5-HT2B receptors died of heart defects during gestation or neonatally, and adult mutant mice displayed cardiopathy, including myocyte disarray and ventricular dilation. Abnormal vascular proliferation causes an increase in pulmonary blood pressure, which is associated with an increase in 5-HT2B receptor, resulting in the development of pulmonary hypertension. It has also been reported that the 5-HT2B is involved in cell-cycle regulation via interaction with tyrosine kinase pathways. 5-HT2B receptors may have a role in the initiation of migraine headaches, and selective antagonists may prove therapeutic in migraine treatment. 5-HT2B receptor is expressed in many tissues including human liver, kidney, lung, heart, pancreas, spleen, brain, spinal cord, gastrointestinal tract, placenta, and coronary and pulmonary arteries. It has also been reported in embryonic mouse heart and spinal cord. ESTs have been isolated from heart/melanocyte/uterus, kidney, prostate, skin, and thyroid libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NLS590
Species: Hu, Pm
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for 5-HT2B Antibody (NBP1-55429)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for 5-HT2B Antibody (NBP1-55429) (0)

There are no reviews for 5-HT2B Antibody (NBP1-55429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 5-HT2B Antibody (NBP1-55429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional 5-HT2B Products

Bioinformatics Tool for 5-HT2B Antibody (NBP1-55429)

Discover related pathways, diseases and genes to 5-HT2B Antibody (NBP1-55429). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2B Antibody (NBP1-55429)

Discover more about diseases related to 5-HT2B Antibody (NBP1-55429).
 

Pathways for 5-HT2B Antibody (NBP1-55429)

View related products by pathway.

PTMs for 5-HT2B Antibody (NBP1-55429)

Learn more about PTMs related to 5-HT2B Antibody (NBP1-55429).
 

Research Areas for 5-HT2B Antibody (NBP1-55429)

Find related products by research area.

Blogs on 5-HT2B

There are no specific blogs for 5-HT2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2B
Entrez
Uniprot