4-1BB Ligand/TNFSF9 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TNFSF9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for 4-1BB Ligand/TNFSF9 Antibody - BSA Free
Background
CD137 exists on the cell surface as a monomer with a molecular mass of 30 kDa and as a dimer of 55 kDa. Human and mouse CD137 share 60% amino acid identity. CD137 (4-1BB), a member of the tumor necrosis factor receptor superfamily, is a type I transmembrane glycoprotein expressed on the cell surface of activated splenic T cells and thymocytes. The functions of CD137 in T lymphocytes include regulating activation, proliferation and apoptosis. CD137 and CD28 are costimulatory molecules of T cell activation. Costimulatory molecules are important in initiating anti-tumor immune responses. CD137 plays an important role in regulating T-cell-dependent immune responses. Expression of CD137 correlates negatively with lymphocyte proliferation and positively with the degree of activation-induced cell death caused by mitogen over stimulation. In monocytes, CD137 induces activation, promotes adherence and prolongs survival.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu
Applications: Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: ELISA
Publications for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103) (0)
There are no publications for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103) (0)
There are no reviews for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 4-1BB Ligand/TNFSF9 Products
Research Areas for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103)
Find related products by research area.
|
Blogs on 4-1BB Ligand/TNFSF9