4-1BB Ligand/TNFSF9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: 4-1BB Ligand/TNFSF9 Antibody [NBP2-56103] - Staining of human cell line SiHa shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

4-1BB Ligand/TNFSF9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
Specificity
Specificity of human 4-1BB Ligand/TNFSF9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFSF9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
4-1BB Ligand/TNFSF9 Recombinant Protein Antigen (NBP2-56103PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for 4-1BB Ligand/TNFSF9 Antibody

  • 41BB Ligand
  • 4-1BB Ligand
  • 4-1BBL
  • 4-1BB-L
  • CD137L
  • homolog of mouse 4-1BB-L
  • receptor 4-1BB ligand
  • TNFSF9
  • tumor necrosis factor (ligand) superfamily, member 9
  • tumor necrosis factor ligand superfamily member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF838
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
AF3388
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB2738
Species: Hu
Applications: Flow
AF1028
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC

Publications for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103) (0)

There are no publications for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103) (0)

There are no reviews for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional 4-1BB Ligand/TNFSF9 Products

Bioinformatics Tool for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103)

Discover related pathways, diseases and genes to 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103)

Discover more about diseases related to 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103).
 

Pathways for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103)

View related products by pathway.

PTMs for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103)

Learn more about PTMs related to 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103).
 

Research Areas for 4-1BB Ligand/TNFSF9 Antibody (NBP2-56103)

Find related products by research area.

Blogs on 4-1BB Ligand/TNFSF9

There are no specific blogs for 4-1BB Ligand/TNFSF9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 4-1BB Ligand/TNFSF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF9