17 beta-HSD1/HSD17B1 Recombinant Protein Antigen

Images

 
There are currently no images for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

17 beta-HSD1/HSD17B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD17B1.

Source: E. coli

Amino Acid Sequence: ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSD17B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39053.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 17 beta-HSD1/HSD17B1 Recombinant Protein Antigen

  • 17 betaHSD1
  • 17 beta-HSD1
  • 17-beta-HSD 1
  • 17-beta-hydroxysteroid dehydrogenase type 1
  • 20 alpha-hydroxysteroid dehydrogenase
  • 20-alpha-HSD
  • E17KSR
  • E2DH
  • EC 1.1.1.62
  • EDH17B1
  • EDH17B2
  • EDH17B2EDHB17
  • EDHB17
  • estradiol 17-beta-dehydrogenase 1
  • estradiol 17-beta-dehydrogenase-1
  • HSD17
  • HSD17B1
  • hydroxysteroid (17-beta) dehydrogenase 1 isoform
  • hydroxysteroid (17-beta) dehydrogenase 1
  • MGC138140
  • Placental 17-beta-hydroxysteroid dehydrogenase
  • SDR28C1
  • short chain dehydrogenase/reductase family 28CE, member 1

Background

The principal human estrogen, 17 beta-estradiol, is a potent stimulator of certain endocrine-dependent forms of breast cancer. Because human estrogenic 17 beta-hydroxysteroid dehydrogenase (HSD17B1) catalyzes the last step in the biosynthesis of 17 beta-estradiol from the less potent estrogen, estrone, it is an attractive target for the design of inhibitors of estrogen production and tumor growth (1). It is concluded that the steroid-binding site of human placental HSD17B1 contains a histidine residue which proximates the upper A-ring region of the steroid as it undergoes the reversible binding step (2). Human estrogenic HSD17B1 is an NADP(H)-preferring enzyme. It possesses 11- and 4-fold higher specificity toward NADP(H) over NAD(H) for oxidation and reduction, respectively, as demonstrated by kinetic studies (3). Defects in the conversion of androstenedione to testosterone in the fetal testes by the enzyme HSD17B1 give rise to genetic males with female external genitalia (4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92011
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-24722
Species: Hu
Applications: IHC,  IHC-P, In vitro, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB

Publications for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP) (0)

There are no publications for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP) (0)

There are no reviews for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 17 beta-HSD1/HSD17B1 Products

Research Areas for 17 beta-HSD1/HSD17B1 Protein (NBP2-39053PEP)

Find related products by research area.

Blogs on 17 beta-HSD1/HSD17B1

There are no specific blogs for 17 beta-HSD1/HSD17B1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 17 beta-HSD1/HSD17B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B1