Zyxin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Zyxin Antibody [NBP1-90349] - Staining of human cell line U-2 OS shows localization to focal adhesion sites. Antibody staining is shown in green.

Analysis in human endometrium and liver tissues using NBP1-90349 antibody. Corresponding ZYX RNA-seq data are presented for the same tissues.

Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Analysis in human cell lines PC-3 and HEK293 using Anti-ZYX antibody. Corresponding ZYX RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Zyxin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Zyxin Antibody - BSA Free (NBP1-90349) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Zyxin Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
• Marker: Focal Adhesion Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZYX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Zyxin Protein (NBP1-90349PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31387632). Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Zyxin Antibody - BSA Free

• CTCL tumor antigen se14-3
• CTCL-associated antigen se14-3
• cutaneous T-cell lymphoma associated antigen se14-3
• Cutaneous T-cell lymphoma-associated antigen se14-3
• KIAA1125
• MGC31836
• predicted protein of HQ2893
• PRKCBP1
• PRO2893
• protein kinase C-binding protein 1
• Rack7
• RACK7protein kinase C binding protein 1
• zinc finger MYND domain containing protein 8
• Zinc finger MYND domain-containing protein 8
• zinc finger, MYND-type containing 8
• Zyx
• Zyxin 2
• Zyxin

Background

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Zyxin Antibody (NBP1-90349)(4)

Publications using NBP1-90349

• Leenders SHAM, Pankratova G, Wijenberg J et Al. Amine Adsorbents Stability for Post-Combustion CO(2) Capture: Determination and Validation of Laboratory Degradation Rates in a Multi-staged Fluidized Bed Pilot Plant ChemSusChem 2023-12-19 [PMID: 37589250]
• Austin J, Tu Y, Pal K, Wang X Vinculin transmits high-level integrin tensions that are dispensable for focal adhesion formation Biophysical journal 2022-11-09 [PMID: 36352785]
• He R, Wang M, Zhao C et al. TFEB-driven autophagy potentiates TGF-beta induced migration in pancreatic cancer cells J. Exp. Clin. Cancer Res. 2019-08-06 [PMID: 31387632] (ICC/IF, Human, Mouse)
• Fukumoto M, Kurisu S, Yamada T. alpha-Actinin-4 Enhances Colorectal Cancer Cell Invasion by Suppressing Focal Adhesion Maturation. PLoS One 2015-01-01 [PMID: 25860875] (ICC/IF)

Bioinformatics

• Gene Symbol: ZYX