Zyxin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Zyxin Antibody [NBP1-90349] - Immunofluorescent staining of human cell line U-2 OS shows localization to focal adhesion sites.
Immunohistochemistry-Paraffin: Zyxin Antibody [NBP1-90349] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zyxin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
Marker
Focal Adhesion Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZYX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Zyxin Protein (NBP1-90349PEP)
Publications
Read Publication using NBP1-90349.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%). Reactivity reported in scientific literature (PMID: 25860875)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Zyxin Antibody

  • CTCL tumor antigen se14-3
  • CTCL-associated antigen se14-3
  • cutaneous T-cell lymphoma associated antigen se14-3
  • Cutaneous T-cell lymphoma-associated antigen se14-3
  • KIAA1125
  • MGC31836
  • predicted protein of HQ2893
  • PRKCBP1
  • PRO2893
  • protein kinase C-binding protein 1
  • Rack7
  • RACK7protein kinase C binding protein 1
  • zinc finger MYND domain containing protein 8
  • Zinc finger MYND domain-containing protein 8
  • zinc finger, MYND-type containing 8
  • Zyx
  • Zyxin 2
  • Zyxin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-79791
Species: Hu
Applications: WB
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07463
Species: Hu
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC

Publications for Zyxin Antibody (NBP1-90349)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for Zyxin Antibody (NBP1-90349) (0)

There are no reviews for Zyxin Antibody (NBP1-90349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Zyxin Antibody (NBP1-90349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zyxin Products

Bioinformatics Tool for Zyxin Antibody (NBP1-90349)

Discover related pathways, diseases and genes to Zyxin Antibody (NBP1-90349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zyxin Antibody (NBP1-90349)

Discover more about diseases related to Zyxin Antibody (NBP1-90349).
 

Pathways for Zyxin Antibody (NBP1-90349)

View related products by pathway.

PTMs for Zyxin Antibody (NBP1-90349)

Learn more about PTMs related to Zyxin Antibody (NBP1-90349).
 

Research Areas for Zyxin Antibody (NBP1-90349)

Find related products by research area.

Blogs on Zyxin

There are no specific blogs for Zyxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zyxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZYX
Entrez