LASP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LASP1 Antibody [NBP1-82844] - Staining in human small intestine and skeletal muscle tissues using anti-LASP1 antibody. Corresponding LASP1 RNA-seq data are presented for the same tissues.

Western Blot: LASP1 Antibody [NBP1-82844] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: LASP1 Antibody [NBP1-82844] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LASP1 Antibody [NBP1-82844] - Staining of human small intestine shows high expression.

Western Blot: LASP1 Antibody [NBP1-82844] - Analysis in human cell line A-549.

Immunohistochemistry-Paraffin: LASP1 Antibody [NBP1-82844] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LASP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LASP1 Antibody - BSA Free (NBP1-82844) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LASP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LASP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LASP1 Protein (NBP1-82844PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LASP1 Antibody - BSA Free

• LASP-1
• LIM and SH3 domain protein 1
• LIM and SH3 protein 1
• Metastatic lymph node gene 50 protein
• MLN 50
• MLN50Lasp-1

Background

LASP1 functions as an actin-binding protein and possibly in cytoskeletal organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LASP1 Antibody (NBP1-82844)(1)

Publication using NBP1-82844

• Ngan E, Northey JJ, Brown CM et al. A complex containing LPP and alpha-Actinin mediates TGF-beta-induced migration and invasion of ErbB2-expressing breast cancer cells. J Cell Sci 2013-05-01 [PMID: 23447672]

Bioinformatics

• Gene Symbol: LASP1