LASP1 Antibody

Images

 
Western Blot: LASP1 Antibody [NBP1-82844] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: LASP1 Antibody [NBP1-82844] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: LASP1 Antibody [NBP1-82844] - Staining of human tonsil shows distinct cytoplasmic positivity in cells in reaction center.
Western Blot: LASP1 Antibody [NBP1-82844] - Analysis in human cell line A-549.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LASP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LASP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LASP1 Protein (NBP1-82844PEP)
Publications
Read Publication using NBP1-82844.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23447672)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LASP1 Antibody

  • LASP-1
  • LIM and SH3 domain protein 1
  • LIM and SH3 protein 1
  • Metastatic lymph node gene 50 protein
  • MLN 50
  • MLN50Lasp-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45223
Species: Hu, Mu, Ca
Applications: IHC-P, PEP-ELISA
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20861
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-86267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LASP1 Antibody (NBP1-82844)(1)

Reviews for LASP1 Antibody (NBP1-82844) (0)

There are no reviews for LASP1 Antibody (NBP1-82844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LASP1 Antibody (NBP1-82844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LASP1 Products

Bioinformatics Tool for LASP1 Antibody (NBP1-82844)

Discover related pathways, diseases and genes to LASP1 Antibody (NBP1-82844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LASP1 Antibody (NBP1-82844)

Discover more about diseases related to LASP1 Antibody (NBP1-82844).
 

Pathways for LASP1 Antibody (NBP1-82844)

View related products by pathway.

PTMs for LASP1 Antibody (NBP1-82844)

Learn more about PTMs related to LASP1 Antibody (NBP1-82844).

Blogs on LASP1

There are no specific blogs for LASP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LASP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LASP1