ZSCAN21/ZFP38 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.

ChIP-Exo-Seq composite graph for Anti-ZSCAN21 (NBP1-84182) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: Simple Western, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZSCAN21/ZFP38 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZSCAN21/ZFP38 Antibody - BSA Free (NBP1-84182) is a polyclonal antibody validated for use in IHC and Simple Western. Anti-ZSCAN21/ZFP38 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHA
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZSCAN21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Simple Western 1:30
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: antibody dilution of 1:30
• Control Peptide:

  ZSCAN21/ZFP38 Protein (NBP1-84182PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZSCAN21/ZFP38 Antibody - BSA Free

• DKFZp434L134
• KOX25
• NY-REN-21
• Renal carcinoma antigen NY-REN-21
• ZFP38
• zfp-38
• ZFP383
• zinc finger and SCAN domain containing 21
• zinc finger and SCAN domain-containing protein 21
• zinc finger protein 38 (KOX 25)
• Zinc finger protein 38 homolog
• zinc finger protein 38
• zinc finger protein NY-REN-21 antigen
• Zipro1
• ZNF38
• ZNF38DKFZp686H10254
• ZSCAN21

Background

Strong transcriptional activator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZSCAN21/ZFP38 Antibody (NBP1-84182)(1)

Publication using NBP1-84182

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ZSCAN21