ZSCAN21/ZFP38 Antibody

Images

 
Western Blot: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western Blot: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in tubule cells.
Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZSCAN21/ZFP38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHA
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZSCAN21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZSCAN21/ZFP38 Protein (NBP1-84182PEP)
Publications
Read Publication using NBP1-84182.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZSCAN21/ZFP38 Antibody

  • DKFZp434L134
  • KOX25
  • NY-REN-21
  • Renal carcinoma antigen NY-REN-21
  • ZFP38
  • Zfp-38
  • ZFP383
  • zinc finger and SCAN domain containing 21
  • zinc finger and SCAN domain-containing protein 21
  • zinc finger protein 38 (KOX 25)
  • Zinc finger protein 38 homolog
  • zinc finger protein 38
  • zinc finger protein NY-REN-21 antigen
  • Zipro1
  • ZNF38
  • ZNF38DKFZp686H10254
  • ZSCAN21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-56092
Species: Hu
Applications: ICC/IF, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-45693
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-2593
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-45693
Species: Hu, Mu, Rt
Applications: IHC, WB
423-F8/CF
Species: Hu, Mu
Applications: BA
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84182
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ZSCAN21/ZFP38 Antibody (NBP1-84182)(1)

Reviews for ZSCAN21/ZFP38 Antibody (NBP1-84182) (0)

There are no reviews for ZSCAN21/ZFP38 Antibody (NBP1-84182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZSCAN21/ZFP38 Antibody (NBP1-84182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZSCAN21/ZFP38 Products

Bioinformatics Tool for ZSCAN21/ZFP38 Antibody (NBP1-84182)

Discover related pathways, diseases and genes to ZSCAN21/ZFP38 Antibody (NBP1-84182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZSCAN21/ZFP38 Antibody (NBP1-84182)

Discover more about diseases related to ZSCAN21/ZFP38 Antibody (NBP1-84182).
 

Pathways for ZSCAN21/ZFP38 Antibody (NBP1-84182)

View related products by pathway.

Blogs on ZSCAN21/ZFP38

There are no specific blogs for ZSCAN21/ZFP38, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZSCAN21/ZFP38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN21