ZSCAN21/ZFP38 Antibody

Images

 
Western Blot: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in tubule cells.
Western Blot: ZSCAN21/ZFP38 Antibody [NBP1-84182] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-666

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZSCAN21/ZFP38 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZSCAN21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZSCAN21/ZFP38 Protein (NBP1-84182PEP)
Publications
Read Publication using NBP1-84182.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZSCAN21/ZFP38 Antibody

  • DKFZp434L134
  • KOX25
  • NY-REN-21
  • Renal carcinoma antigen NY-REN-21
  • ZFP38
  • zfp-38
  • ZFP383
  • zinc finger and SCAN domain containing 21
  • zinc finger and SCAN domain-containing protein 21
  • zinc finger protein 38 (KOX 25)
  • Zinc finger protein 38 homolog
  • zinc finger protein 38
  • zinc finger protein NY-REN-21 antigen
  • Zipro1
  • ZNF38
  • ZNF38DKFZp686H10254
  • ZSCAN21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-56092
Species: Hu
Applications: WB, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-31318
Species: Mu
Applications: IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-31318
Species: Mu
Applications: IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-84182
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ZSCAN21/ZFP38 Antibody (NBP1-84182)(1)

Reviews for ZSCAN21/ZFP38 Antibody (NBP1-84182) (0)

There are no reviews for ZSCAN21/ZFP38 Antibody (NBP1-84182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZSCAN21/ZFP38 Antibody (NBP1-84182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZSCAN21/ZFP38 Products

Bioinformatics Tool for ZSCAN21/ZFP38 Antibody (NBP1-84182)

Discover related pathways, diseases and genes to ZSCAN21/ZFP38 Antibody (NBP1-84182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZSCAN21/ZFP38 Antibody (NBP1-84182)

Discover more about diseases related to ZSCAN21/ZFP38 Antibody (NBP1-84182).
 

Pathways for ZSCAN21/ZFP38 Antibody (NBP1-84182)

View related products by pathway.

Blogs on ZSCAN21/ZFP38

There are no specific blogs for ZSCAN21/ZFP38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZSCAN21/ZFP38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN21
Entrez