ZNHIT3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNHIT3 Antibody [NBP3-17332] - Staining of human epididymis shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNHIT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNHIT3 Antibody - BSA Free (NBP3-17332) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNHIT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNHIT3 Antibody - BSA Free

• HNF-4a coactivator
• Thyroid hormone receptor interactor 3TR-interacting protein 3
• Thyroid receptor-interacting protein 3
• TRIP-3
• TRIP3thyroid receptor interacting protein 3
• zinc finger HIT domain-containing protein 3
• zinc finger, HIT domain containing 3
• zinc finger, HIT type 3
• zinc finger, HIT-type containing 3

Background

ZNHIT3/TRIP3 interacts with HNF-4 alpha, a transcription factor involved in glucose metabolism. As a protein associated with HNF-4, ZNHIT3/TRIP3 functions as a transcriptional coactivator. Alternate names for ZNHIT3/TRIP3 include Zinc finger HIT domain-containing protein 3, thyroid receptor-interacting protein 3, and HNF4a coactivator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNHIT3